DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nek2 and NEK3

DIOPT Version :9

Sequence 1:NP_572415.1 Gene:Nek2 / 31696 FlyBaseID:FBgn0029970 Length:735 Species:Drosophila melanogaster
Sequence 2:NP_002489.1 Gene:NEK3 / 4752 HGNCID:7746 Length:506 Species:Homo sapiens


Alignment Length:457 Identity:131/457 - (28%)
Similarity:213/457 - (46%) Gaps:101/457 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LQDYEVLAVMGNGSFGTCYKVRDKSTGELFAWKGM----NYDELDEAKCDALVSEISVLRQLQHP 76
            :.||.||.::|.||||....|:.:|:.::||.|.:    ::.....::.:|:     :|.:::||
Human     1 MDDYMVLRMIGEGSFGRALLVQHESSNQMFAMKEIRLPKSFSNTQNSRKEAV-----LLAKMKHP 60

  Fly    77 NIVQYYHHLVNREAKS-VYIVMECCAGGDLAQIVQRARSQRQRFEEPYIWRVLFQLCRALQVCHN 140
            |||.:....   ||:. :|||||.|.||||.|.:::.:.  :.|.|..|.....|:|..:...|.
Human    61 NIVAFKESF---EAEGHLYIVMEYCDGGDLMQKIKQQKG--KLFPEDMILNWFTQMCLGVNHIHK 120

  Fly   141 KIPNGTILHRDIKPANIFLDAAGNAKLGDFGLARMLRRDQSFAASFVGTPHYMSPELVKGRKYDR 205
            |    .:||||||..||||...|..||||||.||:|....:||.::||||:|:.||:.:...|:.
Human   121 K----RVLHRDIKSKNIFLTQNGKVKLGDFGSARLLSNPMAFACTYVGTPYYVPPEIWENLPYNN 181

  Fly   206 KSDVWAVGCLVYEMCALRPPFRGRAFDQLSEKIAQGEFSRIPAIYSTDLQEIIAFMLAVDHEQRP 270
            |||:|::||::||:|.|:.||:..::..|..|:.||..|.:|:.||.:||.::..|...:...||
Human   182 KSDIWSLGCILYELCTLKHPFQANSWKNLILKVCQGCISPLPSHYSYELQFLVKQMFKRNPSHRP 246

  Fly   271 GIEVIIRHPLVVRNISELDGKFP--ILVDSGEDFY--------------TLPSGARL-------- 311
            ....::...:|.|.:.:.   .|  |:::.||:..              |.||..|:        
Human   247 SATTLLSRGIVARLVQKC---LPPEIIMEYGEEVLEEIKNSKHNTPRKKTNPSRIRIALGNEAST 308

  Fly   312 FEDEEED--GVHPELSSTMFTEQYSFNEGYGQRRLSVTGVFTPDLRSELFYSAKRKIFPAKKLQL 374
            .::||:|  |.|.:|.|                           :...|..||.|:         
Human   309 VQEEEQDRKGSHTDLES---------------------------INENLVESALRR--------- 337

  Fly   375 SDPSLYESIRREERAEERQVELAEERRRKKDQEQQKRDQELLKEAPSSPRALTQNIFDEVLKTRL 439
                    :.|||:. .:.|.|    |:.......:|..|  |..|::.....:|.  .:|.:.|
Human   338 --------VNREEKG-NKSVHL----RKASSPNLHRRQWE--KNVPNTALTALENA--SILTSSL 385

  Fly   440 HA 441
            .|
Human   386 TA 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nek2NP_572415.1 STKc_Nek2 18..281 CDD:270857 96/267 (36%)
S_TKc 19..281 CDD:214567 95/266 (36%)
NEK3NP_002489.1 Interaction with VAV2. /evidence=ECO:0000269|PubMed:15618286 1..285 102/300 (34%)
STKc_Nek3 3..257 CDD:173759 96/267 (36%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 302..325 6/22 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 441..490
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D132059at33208
OrthoFinder 1 1.000 - - FOG0000168
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.