DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nek2 and nek8

DIOPT Version :9

Sequence 1:NP_572415.1 Gene:Nek2 / 31696 FlyBaseID:FBgn0029970 Length:735 Species:Drosophila melanogaster
Sequence 2:XP_012812229.1 Gene:nek8 / 448753 XenbaseID:XB-GENE-990378 Length:698 Species:Xenopus tropicalis


Alignment Length:414 Identity:121/414 - (29%)
Similarity:198/414 - (47%) Gaps:72/414 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LQDYEVLAVMGNGSFGTCYKVRDKSTGELFAWKGMNYDELDEAKCDALVSEISVLRQLQHPNIVQ 80
            ::.|:.:.|:|.|:||..:....|:..:|...|.:..:::.:.:..|..:|..||:.|.||||::
 Frog     1 MEKYKKIRVVGRGAFGIVHLCLRKADQKLVIIKQIPVEQMTKDERLAAQNECQVLKLLSHPNIIE 65

  Fly    81 YYHHLVNREAKSVYIVMECCAGGDLAQIVQRARSQRQRFEEPYIWRVLFQLCRALQVCHNKIPNG 145
            ||.:.:  |.|::.||||...||.||:.:|:..:  ...:|..|.....|:..||...|.|:   
 Frog    66 YYENFL--EDKALMIVMEYAPGGTLAEYIQKRCN--SLLDEDTILHFFVQILLALHHVHTKL--- 123

  Fly   146 TILHRDIKPANIFLDAAGN-AKLGDFGLARMLRRDQSFAASFVGTPHYMSPELVKGRKYDRKSDV 209
             |||||:|..||.||.... .|:||||::::| ..:|.|.:.||||.|:||||.:|:.|::|||:
 Frog   124 -ILHRDLKTQNILLDKHQMIVKIGDFGISKIL-SSKSKAYTVVGTPCYISPELCEGKPYNQKSDI 186

  Fly   210 WAVGCLVYEMCALRPPFRGRAFDQLSEKIAQGEFSRIPAIYSTDLQEIIAFMLAVDHEQRPGIEV 274
            ||:||::||:.:|:..|.......|..||..|.|:.|...||.:|:.:|..||.:|..:||.:..
 Frog   187 WALGCVLYELTSLKRAFEAANLPALVLKIMSGTFAPISDRYSPELRHLILSMLNLDPSKRPQLNE 251

  Fly   275 IIRHPLVVRNISELDGKFPILVDSGEDFYT------------------------LPS----GARL 311
            |:.||:.:          |.|::...|..:                        :||    |.|:
 Frog   252 IMAHPICI----------PALLNLYSDIGSVKMRRVEKPLASVPAVSRVRPASRIPSARSRGGRV 306

  Fly   312 FEDEEEDGVHPELSSTMFTEQYSFNEGYGQRRLSVTGVFTPDLRSELFY-------------SAK 363
            .....:.|:.|.|||.     |::..|..      |.:..|.|.:|:..             |.:
 Frog   307 GHSPAKPGIPPPLSSV-----YTWGSGIS------TPLRLPMLNTEVVQVSAGRTQKAGVTKSGR 360

  Fly   364 RKIFPAKKLQLSDPSLYESIRREE 387
            ..::.|..:....|||..||...:
 Frog   361 LIMWEATPVGTGAPSLPGSIEHAQ 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nek2NP_572415.1 STKc_Nek2 18..281 CDD:270857 96/263 (37%)
S_TKc 19..281 CDD:214567 96/262 (37%)
nek8XP_012812229.1 STKc_Nek8 3..258 CDD:270859 96/263 (37%)
S_TKc 4..256 CDD:214567 94/260 (36%)
ATS1 320..657 CDD:227511 15/76 (20%)
RCC1 421..465 CDD:278826
RCC1 470..517 CDD:278826
RCC1 587..635 CDD:278826
RCC1 638..687 CDD:278826
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 1 1.000 - - FOG0000168
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R445
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.040

Return to query results.
Submit another query.