DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nek2 and nek7

DIOPT Version :9

Sequence 1:NP_572415.1 Gene:Nek2 / 31696 FlyBaseID:FBgn0029970 Length:735 Species:Drosophila melanogaster
Sequence 2:NP_001003617.1 Gene:nek7 / 445223 ZFINID:ZDB-GENE-040801-136 Length:297 Species:Danio rerio


Alignment Length:271 Identity:97/271 - (35%)
Similarity:155/271 - (57%) Gaps:10/271 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 MDFSQKTLQDYEVLAVMGNGSFGTCYKVRDKSTGELFAWKGMNYDELDEAKC-DALVSEISVLRQ 72
            :|....:|.::.:...:|.|.|...|:........:.|.|.:...:|.:||. ...:.||.:|:|
Zfish    20 IDMGYNSLANFAIEKKIGRGQFSEVYRATYVLDHTIVALKKIQIFDLMDAKARQDCIKEIDLLKQ 84

  Fly    73 LQHPNIVQYYHHLVNREAKSVYIVMECCAGGDLAQIVQRARSQRQRFEEPYIWRVLFQLCRALQV 137
            |.|||:::|:...:  |...:.||:|....|||:|:::..:.||:...|..:|:...|||.||:.
Zfish    85 LNHPNVIKYHASFI--EENELNIVLELADAGDLSQMIRHFKKQRRLIPEKTVWKYFVQLCSALEH 147

  Fly   138 CHNKIPNGTILHRDIKPANIFLDAAGNAKLGDFGLARMLRRDQSFAASFVGTPHYMSPELVKGRK 202
            .|::    .|:||||||||:|:.|.|..||||.||.|......:.|.|.||||:|||||.:....
Zfish   148 MHSR----RIMHRDIKPANVFITATGVVKLGDLGLGRFFSSKTTAAHSLVGTPYYMSPERIHENG 208

  Fly   203 YDRKSDVWAVGCLVYEMCALRPPFRGRAFD--QLSEKIAQGEFSRIPA-IYSTDLQEIIAFMLAV 264
            |:.|||:|::|||:|||.||:.||.|...:  .|.:||.|.::..:|: .||.:|::::...:..
Zfish   209 YNFKSDIWSLGCLLYEMAALQSPFYGDKMNLYSLCKKIEQCDYPPLPSDHYSQELRKLVDMCINP 273

  Fly   265 DHEQRPGIEVI 275
            |.|:||.|..:
Zfish   274 DPEKRPDITYV 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nek2NP_572415.1 STKc_Nek2 18..281 CDD:270857 95/262 (36%)
S_TKc 19..281 CDD:214567 95/261 (36%)
nek7NP_001003617.1 STKc_Nek6_7 29..290 CDD:270863 95/262 (36%)
S_TKc 30..281 CDD:214567 94/256 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000168
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R445
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.