DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nek2 and niki

DIOPT Version :9

Sequence 1:NP_572415.1 Gene:Nek2 / 31696 FlyBaseID:FBgn0029970 Length:735 Species:Drosophila melanogaster
Sequence 2:NP_651293.1 Gene:niki / 42959 FlyBaseID:FBgn0045980 Length:841 Species:Drosophila melanogaster


Alignment Length:292 Identity:101/292 - (34%)
Similarity:166/292 - (56%) Gaps:10/292 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSGEESAGMDFSQKTLQDYEVLAVMGNGSFGTCYKVRDKSTGELFAWKGMNYDELDEAKCDALVS 65
            :|.....|:..:...|.:||.:.|:|.||||.....|.||.|....:|.:|..||.....|..::
  Fly    87 LSVPRETGVGVAGPELANYEKVRVVGQGSFGIAILYRRKSDGHQIVFKQINLSELSPPGRDLAMN 151

  Fly    66 EISVLRQLQHPNIVQYYHHLVNREAKSVYIVMECCAGGDLAQIVQRARSQRQRFEEPYIWRVLFQ 130
            |:.|..:|.|||||.|....:  :..::.|.||...||.||||:.. |..:..|.|.||..|..|
  Fly   152 EVDVFSKLHHPNIVSYLGSFI--KDNTLLIEMEYADGGTLAQIIAE-RQGKLHFPERYIIAVFEQ 213

  Fly   131 LCRALQVCHNKIPNGTILHRDIKPANIFLDAAGNAKLGDFGLARMLRRDQSFAASFVGTPHYMSP 195
            :..|:...|::    .|||||:|.||:||:..|..|:||||::::: ..:..|.:.:|||:|.||
  Fly   214 ISSAINYMHSE----NILHRDLKTANVFLNRRGIVKIGDFGISKIM-NTKIHAQTVLGTPYYFSP 273

  Fly   196 ELVKGRKYDRKSDVWAVGCLVYEMCALRPPFRGRAFDQLSEKIAQGEFSRIPAIYSTDLQEIIAF 260
            |:.:|::||.|||:||:||::.|||.|:..|......:|..||..|.::.:|:.|::.|:.:::.
  Fly   274 EMCEGKEYDNKSDIWALGCILGEMCCLKKTFAASNLSELVTKIMAGNYTPVPSGYTSGLRSLMSN 338

  Fly   261 MLAVDHEQRPGIEVIIRH--PLVVRNISELDG 290
            :|.|:..:||....::.:  ||:.|::.:..|
  Fly   339 LLQVEAPRRPTASEVLVYWIPLIFRSLGKNKG 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nek2NP_572415.1 STKc_Nek2 18..281 CDD:270857 95/264 (36%)
S_TKc 19..281 CDD:214567 95/263 (36%)
nikiNP_651293.1 STKc_Nek 104..359 CDD:270855 94/262 (36%)
S_TKc 105..354 CDD:214567 94/256 (37%)
ATS1 445..747 CDD:227511
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443423
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 1 1.000 - - FOG0000168
OrthoInspector 1 1.000 - - mtm947
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR43671
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R445
SonicParanoid 00.000 Not matched by this tool.
76.980

Return to query results.
Submit another query.