DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nek2 and CG6678

DIOPT Version :9

Sequence 1:NP_572415.1 Gene:Nek2 / 31696 FlyBaseID:FBgn0029970 Length:735 Species:Drosophila melanogaster
Sequence 2:NP_650996.1 Gene:CG6678 / 42581 FlyBaseID:FBgn0038917 Length:373 Species:Drosophila melanogaster


Alignment Length:287 Identity:56/287 - (19%)
Similarity:95/287 - (33%) Gaps:92/287 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 GTCYKVRDKSTGELFAWKGMNYDELDEAKCDALVSEISVLRQLQHPN--IVQY-----YHHLVNR 88
            |..|:|:.|...||.|.:      |:.|......::.|:....:.|:  |:::     :.::...
  Fly    96 GQLYRVQPKLQAELVAVR------LEAAPRSNSGTKRSIFGAAKAPSSPIIEHIACGSHINVAIS 154

  Fly    89 EAKSVYIVMECCAGGDLAQIVQRARSQRQRFEEPYIWRVLFQLCRALQVCHNKIPNGTILHRDIK 153
            ....||.:..|     |.|.     |:||       :||     :.||..|.        |..:.
  Fly   155 SENCVYSIPSC-----LHQF-----SERQ-------FRV-----KQLQCGHE--------HAVLL 189

  Fly   154 PANIFLDAAGNAKLGDFGLARMLRRDQSFAASFVGTPHYMSPELVKGRKYDRKSD---------- 208
            .||..:...||...|..|||. ||.::        ||..:  |.:.|.|..:.:.          
  Fly   190 NANGDVFTWGNGLRGQLGLAE-LRVEE--------TPQLL--EALAGIKITQIAAGGWHSAAISA 243

  Fly   209 -----VWAVGCLVYEMCALRPPFRGRAFDQLSEKIAQ-GEFSRIPAIYS----TDLQEIIAFMLA 263
                 .|.:.|                ..||..::.: |...:.|.::.    .||.|.......
  Fly   244 FGDLYTWGLNC----------------SGQLGLRVMKPGGVLKEPTVFPLPQLQDLPECACSQSG 292

  Fly   264 VDHEQRPGIEVII--RHPLVVRNISEL 288
            ..::....:.|..  ||.|::|....|
  Fly   293 ESNDDCAPLRVFAGSRHTLLIRRCGRL 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nek2NP_572415.1 STKc_Nek2 18..281 CDD:270857 53/278 (19%)
S_TKc 19..281 CDD:214567 53/278 (19%)
CG6678NP_650996.1 ATS1 <78..371 CDD:227511 56/287 (20%)
RCC1_2 176..205 CDD:290274 9/41 (22%)
RCC1 192..241 CDD:278826 14/59 (24%)
RCC1_2 228..257 CDD:290274 2/44 (5%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.