DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nek2 and Sergef

DIOPT Version :9

Sequence 1:NP_572415.1 Gene:Nek2 / 31696 FlyBaseID:FBgn0029970 Length:735 Species:Drosophila melanogaster
Sequence 2:XP_038956885.1 Gene:Sergef / 365243 RGDID:1563497 Length:481 Species:Rattus norvegicus


Alignment Length:297 Identity:54/297 - (18%)
Similarity:85/297 - (28%) Gaps:122/297 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 TGELFAWKGMNYDELDEAKCDALVSEISVLRQLQHPNIVQYYH--------------HL------ 85
            ||||:.|....:.:|           .|:...|..|..|:.::              ||      
  Rat   230 TGELYVWGRNKHGQL-----------ASLATFLPLPQRVEAHYFQDEKVTAVWSGWTHLVAKTGN 283

  Fly    86 -------------VNREAKSVYIVMECCAG----------GDLAQIVQRARSQRQRFEEPYIWRV 127
                         |||..:......|  .|          |.|.:.:....:|:...::..:   
  Rat   284 FRAPWTGMLCFFSVNRGPRGALTTSE--TGKVFTWGRADYGQLGRTLGSPEAQKHGEQDSSL--- 343

  Fly   128 LFQLCRALQVCHNKIPNGTILHRDIKPANIFLDAA-GNAKLGDFGLARMLRRDQSFAASFVGT-P 190
                  |.|...|.:|:         |.:....|| |.:.....|:          ..:.||| |
  Rat   344 ------AFQRLQNSVPS---------PLHCLTGAAEGTSAAPGAGM----------NMACVGTAP 383

  Fly   191 HYMSPELVKGR--KYDRKSDVWAVGCLV---YEMCALRPPFRGRAFDQLSEKIAQGEFSRIPAIY 250
            ..||...::.|  ::.:.|..||||...   |..|              ...:.....||:||  
  Rat   384 SPMSGLQLQCRPCRHHQDSSSWAVGRATPWPYVSC--------------RHTLHHARISRLPA-- 432

  Fly   251 STDLQEIIAFMLAVDHEQRPGIEVIIRHPLVVRNISE 287
                           |.|.|...:.:|.|...|:..|
  Rat   433 ---------------HSQMPQRPLNLRVPWTERDRKE 454

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nek2NP_572415.1 STKc_Nek2 18..281 CDD:270857 52/289 (18%)
S_TKc 19..281 CDD:214567 52/289 (18%)
SergefXP_038956885.1 ATS1 17..>325 CDD:227511 18/107 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.