DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nek2 and Herc3

DIOPT Version :9

Sequence 1:NP_572415.1 Gene:Nek2 / 31696 FlyBaseID:FBgn0029970 Length:735 Species:Drosophila melanogaster
Sequence 2:NP_001102101.1 Gene:Herc3 / 362377 RGDID:1307803 Length:1050 Species:Rattus norvegicus


Alignment Length:229 Identity:37/229 - (16%)
Similarity:69/229 - (30%) Gaps:94/229 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 KSTGELFAWKGMNYDELDEAKCDALVSEISVLRQLQHPNIVQYYHHLVNREAKSVYIVMECCAGG 103
            :|..||..:.|   ::::|..|                     .:..|.||:..|....:...||
  Rat   836 RSLQELLDYPG---EDIEETFC---------------------LNFTVCRESYGVIEQKKLIPGG 876

  Fly   104 DLAQIVQRARSQRQRFEEPYIWRVLFQL----------CRALQVCHNK--------------IPN 144
            |...:   .:..||.|.:.|: ..:||:          ...|:||..|              :.|
  Rat   877 DRVAV---CKDNRQEFVDAYV-NYIFQISVHEWYTAFSSGFLKVCGGKVLELFQPAELRAMMVGN 937

  Fly   145 GTILHRDIKPANIF------------------------------LDAAGNAKLGDFGLARMLRRD 179
            ......:::...::                              |...|:.::..:|:|.:....
  Rat   938 SNYNWEELEETAVYKGDYSSTHPTVKLFWETFHEFPLEKKKRFLLFLTGSDRIPIYGMASLQIVI 1002

  Fly   180 QSFAA------------SFVGTPHYMSPELVKGR 201
            ||.|.            :.:..|.|.|.|::|.|
  Rat  1003 QSTATGEDYLPVAHTCYNLLDLPKYSSKEIMKAR 1036

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nek2NP_572415.1 STKc_Nek2 18..281 CDD:270857 37/229 (16%)
S_TKc 19..281 CDD:214567 37/229 (16%)
Herc3NP_001102101.1 ATS1 2..331 CDD:227511
RCC1 313..377 CDD:395335
HECTc 702..1048 CDD:238033 37/229 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.