Sequence 1: | NP_572415.1 | Gene: | Nek2 / 31696 | FlyBaseID: | FBgn0029970 | Length: | 735 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001102101.1 | Gene: | Herc3 / 362377 | RGDID: | 1307803 | Length: | 1050 | Species: | Rattus norvegicus |
Alignment Length: | 229 | Identity: | 37/229 - (16%) |
---|---|---|---|
Similarity: | 69/229 - (30%) | Gaps: | 94/229 - (41%) |
- Green bases have known domain annotations that are detailed below.
Fly 39 KSTGELFAWKGMNYDELDEAKCDALVSEISVLRQLQHPNIVQYYHHLVNREAKSVYIVMECCAGG 103
Fly 104 DLAQIVQRARSQRQRFEEPYIWRVLFQL----------CRALQVCHNK--------------IPN 144
Fly 145 GTILHRDIKPANIF------------------------------LDAAGNAKLGDFGLARMLRRD 179
Fly 180 QSFAA------------SFVGTPHYMSPELVKGR 201 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Nek2 | NP_572415.1 | STKc_Nek2 | 18..281 | CDD:270857 | 37/229 (16%) |
S_TKc | 19..281 | CDD:214567 | 37/229 (16%) | ||
Herc3 | NP_001102101.1 | ATS1 | 2..331 | CDD:227511 | |
RCC1 | 313..377 | CDD:395335 | |||
HECTc | 702..1048 | CDD:238033 | 37/229 (16%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1062377at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.010 |