DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nek2 and Nek6

DIOPT Version :9

Sequence 1:NP_572415.1 Gene:Nek2 / 31696 FlyBaseID:FBgn0029970 Length:735 Species:Drosophila melanogaster
Sequence 2:NP_001264161.1 Gene:Nek6 / 360161 RGDID:727779 Length:313 Species:Rattus norvegicus


Alignment Length:268 Identity:100/268 - (37%)
Similarity:155/268 - (57%) Gaps:16/268 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 TLQDYEVLAVMGNGSFGTCYK---VRDKSTGELFAWKGMNYDELDEAKC-DALVSEISVLRQLQH 75
            :|.|:::...:|.|.|...||   :.|:.|   .|.|.:...|:.:||. ...|.||.:|:||.|
  Rat    41 SLADFQIEKKIGRGQFSEVYKATCLLDRKT---VALKKVQIFEMMDAKARQDCVKEIGLLKQLNH 102

  Fly    76 PNIVQYYHHLVNREAKSVYIVMECCAGGDLAQIVQRARSQRQRFEEPYIWRVLFQLCRALQVCHN 140
            |||::|....:  |...:.||:|....|||:|:::..:.|::...|..:|:...|||.|::..|:
  Rat   103 PNIIKYLDSFI--EDNELNIVLELADAGDLSQMIKYFKKQKRLIPERTVWKYFVQLCSAVEHMHS 165

  Fly   141 KIPNGTILHRDIKPANIFLDAAGNAKLGDFGLARMLRRDQSFAASFVGTPHYMSPELVKGRKYDR 205
            :    .::||||||||:|:.|.|..||||.||.|....:.:.|.|.||||:|||||.:....|:.
  Rat   166 R----RVMHRDIKPANVFITATGIVKLGDLGLGRFFSSETTAAHSLVGTPYYMSPERIHENGYNF 226

  Fly   206 KSDVWAVGCLVYEMCALRPPFRGRAFD--QLSEKIAQGEFSRIPA-IYSTDLQEIIAFMLAVDHE 267
            |||:|::|||:|||.||:.||.|...:  .|.:||.|.::..:|. .||..|:|:::..:..|..
  Rat   227 KSDIWSLGCLLYEMAALQSPFYGDKMNLFSLCQKIEQCDYPPLPGEHYSEKLRELVSMCIYPDPN 291

  Fly   268 QRPGIEVI 275
            .||.||.:
  Rat   292 HRPDIEYV 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nek2NP_572415.1 STKc_Nek2 18..281 CDD:270857 99/265 (37%)
S_TKc 19..281 CDD:214567 98/264 (37%)
Nek6NP_001264161.1 Interaction with ARHGAP33, ANKRA2, CDC42, PRDX3, RAD26L, RBBP6, RPS7 and TRIP4. /evidence=ECO:0000250 1..44 1/2 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..31
STKc_Nek6_7 44..305 CDD:270863 99/265 (37%)
Interaction with APBB1. /evidence=ECO:0000250 267..270 0/2 (0%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000168
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.