Sequence 1: | NP_572415.1 | Gene: | Nek2 / 31696 | FlyBaseID: | FBgn0029970 | Length: | 735 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001285655.1 | Gene: | CG9135 / 33850 | FlyBaseID: | FBgn0031769 | Length: | 487 | Species: | Drosophila melanogaster |
Alignment Length: | 258 | Identity: | 49/258 - (18%) |
---|---|---|---|
Similarity: | 85/258 - (32%) | Gaps: | 87/258 - (33%) |
- Green bases have known domain annotations that are detailed below.
Fly 143 PNGTI-LHRDIK--------PA---------------NIFLD------AAGNAKLGDFGLARMLR 177
Fly 178 RDQSFAASFVGTP-HYMSPELVKGRKYDRKSDVWAVGC-----LVYEMCALRPPFRGRAFDQLSE 236
Fly 237 KIAQGEFSRIPAIYSTDLQEII-AFMLAVDHEQRPGIEVIIRHPLVVRNISELDG---------- 290
Fly 291 KFPILVDSGEDFYTLPSG--ARLFEDEEEDGVHPELSSTMFTEQYSFNEGYGQRRLSVTGVFT 351 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Nek2 | NP_572415.1 | STKc_Nek2 | 18..281 | CDD:270857 | 32/174 (18%) |
S_TKc | 19..281 | CDD:214567 | 32/174 (18%) | ||
CG9135 | NP_001285655.1 | RCC1 | 139..184 | CDD:278826 | 8/39 (21%) |
RCC1_2 | 171..200 | CDD:290274 | 5/28 (18%) | ||
RCC1 | 188..236 | CDD:278826 | 12/65 (18%) | ||
RCC1 | 239..312 | CDD:278826 | 12/86 (14%) | ||
RCC1 | 317..366 | CDD:278826 | 13/53 (25%) | ||
RCC1 | 414..465 | CDD:278826 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1062377at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.010 |