DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nek2 and CG9135

DIOPT Version :9

Sequence 1:NP_572415.1 Gene:Nek2 / 31696 FlyBaseID:FBgn0029970 Length:735 Species:Drosophila melanogaster
Sequence 2:NP_001285655.1 Gene:CG9135 / 33850 FlyBaseID:FBgn0031769 Length:487 Species:Drosophila melanogaster


Alignment Length:258 Identity:49/258 - (18%)
Similarity:85/258 - (32%) Gaps:87/258 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   143 PNGTI-LHRDIK--------PA---------------NIFLD------AAGNAKLGDFGLARMLR 177
            |:|.: |.:|||        ||               .:||.      |.|..|.|..|:.    
  Fly   144 PSGQLGLSQDIKLAEKPTIIPALEQLNIVQAAVGRHHTLFLTDTGTVYACGENKSGQCGVG---- 204

  Fly   178 RDQSFAASFVGTP-HYMSPELVKGRKYDRKSDVWAVGC-----LVYEMCALRPPFRGRAFDQLSE 236
              .:.|..:..|| :|..|.:::            :||     ::.::......|....:.||. 
  Fly   205 --NTHANIYSPTPINYRGPPIIR------------IGCGAEFSVILDIKGSLHTFGLPEYGQLG- 254

  Fly   237 KIAQGEFSRIPAIYSTDLQEII-AFMLAVDHEQRPGIEVIIRHPLVVRNISELDG---------- 290
                         ::||.:..: |..|:...|..|...|:........:::.:||          
  Fly   255 -------------HNTDAKYFVNANKLSFHFETSPKKVVLYIEKSKEGHVTPVDGVQIVDFACGN 306

  Fly   291 KFPILVDSGEDFYTLPSG--ARLFEDEEEDGVHPELSSTMFTEQYSFNEGYGQRRLSVTGVFT 351
            ...:.:||.:..|:...|  .||...|.:|.:.|.|.....|      :|.|.|.:.....|:
  Fly   307 NHTVAIDSKKRVYSWGFGGFGRLGHAEPKDEMVPRLMKFFDT------QGRGGRSVFCGSTFS 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nek2NP_572415.1 STKc_Nek2 18..281 CDD:270857 32/174 (18%)
S_TKc 19..281 CDD:214567 32/174 (18%)
CG9135NP_001285655.1 RCC1 139..184 CDD:278826 8/39 (21%)
RCC1_2 171..200 CDD:290274 5/28 (18%)
RCC1 188..236 CDD:278826 12/65 (18%)
RCC1 239..312 CDD:278826 12/86 (14%)
RCC1 317..366 CDD:278826 13/53 (25%)
RCC1 414..465 CDD:278826
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.