DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nek2 and CG7420

DIOPT Version :9

Sequence 1:NP_572415.1 Gene:Nek2 / 31696 FlyBaseID:FBgn0029970 Length:735 Species:Drosophila melanogaster
Sequence 2:NP_001259871.1 Gene:CG7420 / 33332 FlyBaseID:FBgn0031344 Length:388 Species:Drosophila melanogaster


Alignment Length:161 Identity:37/161 - (22%)
Similarity:61/161 - (37%) Gaps:45/161 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 ELD-EAKCDALVSEISVLRQLQHPNIVQYYHHLVNREAKSVYIVMECC-----AGGDLAQIV--- 109
            ||| .|.|....:.:.:  |:.:||.::    :|:..:...::|::|.     .||...:|:   
  Fly   182 ELDITATCLHRCNTVKI--QVHNPNELR----IVSISSGQNHMVLKCADLSETGGGSTKRILTLG 240

  Fly   110 --QRARSQRQRFEEPYIWRVLFQLCRALQV--CHNK--IPNGTILHRDIKPANIFLDAAGNAKLG 168
              :..:|...:|||.         .|.|.|  .||.  :.|..||   :...|.:    |...:|
  Fly   241 DNKFGQSNAFQFEED---------VRQLAVGWTHNAAVLKNNEIL---VWGRNCY----GQLGMG 289

  Fly   169 DFG--------LARMLRRDQSFAASFVGTPH 191
            .|.        |...|..||..|...:|..|
  Fly   290 SFSEQQAIPTPLRLKLPEDQGPARIHMGAEH 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nek2NP_572415.1 STKc_Nek2 18..281 CDD:270857 37/161 (23%)
S_TKc 19..281 CDD:214567 37/161 (23%)
CG7420NP_001259871.1 RCC1 2..52 CDD:278826
RCC1 55..107 CDD:278826
RCC1 112..161 CDD:278826
RCC1_2 256..285 CDD:290274 9/35 (26%)
RCC1 274..320 CDD:278826 12/52 (23%)
RCC1 328..>348 CDD:278826
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.