DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nek2 and HERC2

DIOPT Version :9

Sequence 1:NP_572415.1 Gene:Nek2 / 31696 FlyBaseID:FBgn0029970 Length:735 Species:Drosophila melanogaster
Sequence 2:NP_608388.2 Gene:HERC2 / 33035 FlyBaseID:FBgn0031107 Length:4912 Species:Drosophila melanogaster


Alignment Length:694 Identity:146/694 - (21%)
Similarity:247/694 - (35%) Gaps:211/694 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 WKGMNYDELDEAKCDALVSEISVLRQLQHPNIVQYYHHLVNREA---KSVYIVMECCAGGDLAQI 108
            |..:.:.......|..|..|:|.      |..:.:|..|:.:.|   ..||..:.|      .::
  Fly  2074 WLNLGFIRAISGDCPRLCLELST------PGWLSHYLSLLEQPAGNEAGVYRQLHC------LRL 2126

  Fly   109 VQRARSQRQRFEEPYIWRVLFQLCRALQVCHNKIPNGTILHRDIKPANIFLDAAGNAKL--GDFG 171
            :|...:|....|||.:..::.||...|                   ..|.|...|:|.|  ...|
  Fly  2127 LQLILAQWGAEEEPRMPALVHQLFATL-------------------GRIALHCPGDASLLPTAEG 2172

  Fly   172 LARMLRRDQSFAASFVGTPHYMSPELVKGRKYDRKSDVW---AVGCLVYEMCALRPPFRGRAFDQ 233
            .||:|     ..||..|:   ::.|||...:.......|   ....|..::|.        |.:.
  Fly  2173 KARVL-----LTASHSGS---VAEELVALLRRLHTLPSWNPVINSFLAQKLCV--------AAEL 2221

  Fly   234 LSEKIAQGEFSRIPAIYSTDLQEIIAFMLAV-----DHEQRPGIEVIIRHP---LVVRNISELDG 290
            |:|:           .:||.|.....|:|.|     .|:.||.:.:...|.   :|:.:.:. .|
  Fly  2222 LAEQ-----------SHSTALDSEQVFVLGVLGAMGGHDLRPRVGLHCFHEGSHMVIASFTP-KG 2274

  Fly   291 K---FPILVDSGEDF--YTLPSGARLFEDEEEDGVHPELSSTMFT-EQYSFNEG---------YG 340
            :   .|..|.||..|  ..||:            |.|.|..|:|: .:...||.         ||
  Fly  2275 RCLLAPGGVGSGVGFVKVQLPA------------VMPHLDHTVFSLSRLPMNEMLLNAWTVLLYG 2327

  Fly   341 QRRLSVTGVFTPDLRSELFYSAKRK----IFPAKKLQL----SDPSLYE---SIRR--EERAEER 392
            .         .|:|| ||..||..:    :..|::||:    ::..||.   ::||  ::||...
  Fly  2328 P---------APELR-ELPSSADGRLDLALLRAQQLQMAVLHTNGVLYRHQVALRRILKQRAPGS 2382

  Fly   393 QVELAEERRRKKDQEQQ--KRDQELLKEAPSSPRALTQNIFDEVLKTRLHAIRAQESLLQQKLEE 455
            .....:|..|...:.||  ::||:|...:...|:.|.|.|.  :..|:...::|..|.:     :
  Fly  2383 IYASPDEPDRSDAESQQPGEQDQQLSSGSGQEPQLLIQCIL--LRATQASPVKACYSYM-----D 2440

  Fly   456 LQTREQELQLAEQRVQTLERQMQEKLLQQEKHTCSCRQPIAPPIP--------------PRKPAK 506
            |.|      .|...:|:|..|..::|.:......:.|...:||.|              .:||::
  Fly  2441 LAT------AALNCIQSLATQAHQELSEGGGVPPNGRALSSPPQPTMVHGVPVYNVARKEQKPSE 2499

  Fly   507 SHHD---------DTYCTIELNETSPTVAKLNLATLPAPKSLNTLRKVTFKSPQKFVTYGIENMP 562
            ....         |.....::.|...|...:.||.    |.| :|:.....:|::.|.:.:|:  
  Fly  2500 QVEQKSKWPAAATDAQLIGQIMEMGFTRRTVELAL----KQL-SLQAEIMPTPEQIVQWILEH-- 2557

  Fly   563 PPAVKPAVNPPPTGVPMQMSVSSND---SGDSQASSTRRKSILSLFGLSRGSKATSKSLPSVNQV 624
             |.|........| :|:..|.||:|   ..|::..|               |.:|:.|       
  Fly  2558 -PDVCANTIEEDT-LPLASSASSHDPEADSDNECPS---------------SNSTTSS------- 2598

  Fly   625 AQAAATRVQRPPLAVKPPITQEQPAEVPPVANLWTKEQKKQAFE 668
             ..::..|:..|:||..|        .|||     |.:.::.|:
  Fly  2599 -STSSDTVEGQPMAVSGP--------APPV-----KFESRKDFQ 2628

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nek2NP_572415.1 STKc_Nek2 18..281 CDD:270857 51/249 (20%)
S_TKc 19..281 CDD:214567 51/249 (20%)
HERC2NP_608388.2 RCC1 638..683 CDD:278826
RCC1 687..737 CDD:278826
RCC1 740..787 CDD:278826
RCC1 790..841 CDD:278826
RCC1_2 828..857 CDD:290274
Cyt-b5 1290..1363 CDD:278597
MIB_HERC2 1928..1987 CDD:284184
UBA_HERC2 2515..2559 CDD:270585 10/51 (20%)
Cul7 2624..2699 CDD:288381 1/5 (20%)
APC10-HERC2 2762..2932 CDD:176485
RCC1 3037..3088 CDD:278826
RCC1 3091..3140 CDD:278826
RCC1 3144..3194 CDD:278826
RCC1 3197..3246 CDD:278826
RCC1 3250..3298 CDD:278826
RCC1 3302..3350 CDD:278826
RCC1_2 4136..4166 CDD:290274
RCC1 4154..4203 CDD:278826
RCC1 4206..4257 CDD:278826
RCC1 4260..4309 CDD:278826
RCC1 4312..4360 CDD:278826
RCC1 4364..4413 CDD:278826
HECTc 4509..4880 CDD:238033
HECTc 4553..4878 CDD:214523
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.