DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nek2 and Hectd3

DIOPT Version :9

Sequence 1:NP_572415.1 Gene:Nek2 / 31696 FlyBaseID:FBgn0029970 Length:735 Species:Drosophila melanogaster
Sequence 2:XP_008762291.1 Gene:Hectd3 / 313525 RGDID:1309823 Length:861 Species:Rattus norvegicus


Alignment Length:529 Identity:106/529 - (20%)
Similarity:179/529 - (33%) Gaps:170/529 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 LFAWKGMNYDELDEAKCD-ALVSEISVLRQLQHPNIVQYYHHLVNREAKSVYIVMECCAGG-DLA 106
            ::..:|.|..:|.:...| .|:.::.||..:.        .||...|.:    ::||...| |:.
  Rat   312 VYGGEGDNLKKLSDVNIDETLIGDVCVLEDMT--------VHLPVIEIR----IVECRDDGIDVR 364

  Fly   107 QIVQRARSQRQR--------FEEPYIWR----------VLFQLCRALQ--------VCHNKIPN- 144
            ....:.:|.|||        |:...:.|          ||::....||        |.|:.:|. 
  Rat   365 LRGVKIKSSRQRELGLNADLFQPASLVRYPRLEGTDPEVLYRRAVLLQRFIKILDSVLHHLVPAW 429

  Fly   145 ----GTILHRDIKPANIFLDAAGNAKLGDFGLARM--------LRRDQSFAASFVGTPHYMSPEL 197
                ||.  .:||....||           .|:|.        ||..:|...||:       |.|
  Rat   430 DHTLGTF--SEIKQVKQFL-----------LLSRQRPSLVTQCLRDSESSKPSFM-------PRL 474

  Fly   198 VKGRKYDRKSDVWAVGCLVYEMCALR-PPFRGRAFDQLSEKIAQGEFSRIPAIYSTDLQ------ 255
            ...|:.          .:.:..|..| |..:...|.|:.|.:...:....|..|...::      
  Rat   475 YINRRL----------AMEHRACPSRDPACKNAVFTQVYEGLKPSDKYEKPLDYRWPMRYDQWWE 529

  Fly   256 -EIIA------------FMLAVDHEQRP-GIEVIIRHPLVVRNISELDGKFPILVDSGE--DFYT 304
             :.||            .:..:..|..| ..:..:..|..||..::.:|       :||  |.|.
  Rat   530 CKFIAEGIIDQGGGFRDSLADMSEELCPSSADTPVPLPFFVRTANQGNG-------TGEARDMYV 587

  Fly   305 LPSGARLFEDEEEDG--------------------VHPELSSTMFTEQYSFNEGYGQRRLSVTGV 349
            .....|.|...|..|                    |..:||.    |:.|:::.:.    :|..|
  Rat   588 PNPSCRDFAKYEWIGQLMGAALRGKEFLVLALPGFVWKQLSG----EEVSWSKDFP----AVDSV 644

  Fly   350 FTPDLRSELFYSAKRKIFP---AKKLQ----LSDPSLYESI--------RREERAEERQVELAEE 399
            ....|  |:.....::.|.   .|:|.    |||..:.|.|        ..|:|.  |.::|.::
  Rat   645 LVKLL--EVMEGVDKETFEFKFGKELTFTTVLSDQQVVELIPGGTGIVVGYEDRL--RFIQLVQK 705

  Fly   400 RRRKKDQEQQKRDQE-LLKEAPSSPRALTQNIFDEVLKTRLH-AIRAQESLLQQKLEELQTREQE 462
            .|.::.:||....|. |||..|       |.:.|.:....|. .:.....:....|.:| ||.::
  Rat   706 ARLEESKEQVAAMQAGLLKVVP-------QAVLDLLTWQELEKKVCGDPEVTVDALRKL-TRFED 762

  Fly   463 LQLAEQRVQ 471
            .:.::.|||
  Rat   763 FEPSDTRVQ 771

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nek2NP_572415.1 STKc_Nek2 18..281 CDD:270857 56/298 (19%)
S_TKc 19..281 CDD:214567 56/298 (19%)
Hectd3XP_008762291.1 APC10-HECTD3 238..371 CDD:176487 14/70 (20%)
HECT 579..845 CDD:395507 47/213 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.