DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nek2 and png

DIOPT Version :9

Sequence 1:NP_572415.1 Gene:Nek2 / 31696 FlyBaseID:FBgn0029970 Length:735 Species:Drosophila melanogaster
Sequence 2:NP_477492.1 Gene:png / 31084 FlyBaseID:FBgn0000826 Length:291 Species:Drosophila melanogaster


Alignment Length:280 Identity:78/280 - (27%)
Similarity:121/280 - (43%) Gaps:61/280 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 VMGNGSFG-----------------TCYK---VRDKSTGELFAWKGMNYDELDEAKCDALVSEIS 68
            |:|.|:||                 .|.|   ||:..|            ||...|     .|:.
  Fly    13 VLGQGTFGRVFLCHQNEVRGQPERKVCVKRIIVRNPKT------------ELGLIK-----EEVY 60

  Fly    69 VLRQLQHPNIVQY---YHHLVNREAKSVYIVMECCAGGDLAQIVQRARSQRQRFEEPYIWRVLFQ 130
            ::.||:||:||::   :.|     |.:|.||||....|.|..::|:..|......:..:......
  Fly    61 IISQLRHPHIVEFLRSFSH-----AGTVNIVMEYVPNGTLRDVIQQLPSGTGGVNQERLMGYFRD 120

  Fly   131 LCRALQVCHNKIPNGTILHRDIKPANIFLDAAGNAKLGDFGLARMLRRDQSFAASFVGTPHYMSP 195
            :...|:..|.:    .::||||||.|:.|||....|:.|||:|.:........|. :|||.||:|
  Fly   121 MVVGLEYLHIR----CVIHRDIKPENMLLDANDRVKIADFGIANVHAPSTQLQAG-MGTPMYMAP 180

  Fly   196 ELVKGR-KYDRKSDVWAVGCLVYEMCALRPPFRG----RAFDQLSEKIAQG------EFSRIPAI 249
            |.:..: |.|.|||||::|.::||:|..|.||..    .|...|...:.|.      :...|..:
  Fly   181 EAMSSQGKVDFKSDVWSLGLVLYELCLGRSPFAAFLDKNATPALLHTVVQALVRPRLDCQLIRRL 245

  Fly   250 YSTDLQEIIAFMLAVDHEQR 269
            |.....::...|:..:.|:|
  Fly   246 YDPVWAQVCELMVVYEQERR 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nek2NP_572415.1 STKc_Nek2 18..281 CDD:270857 78/280 (28%)
S_TKc 19..281 CDD:214567 78/280 (28%)
pngNP_477492.1 PKc_like 9..>214 CDD:304357 70/227 (31%)
S_TKc 11..271 CDD:214567 78/280 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443425
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000168
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.