DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nek2 and Nek9

DIOPT Version :9

Sequence 1:NP_572415.1 Gene:Nek2 / 31696 FlyBaseID:FBgn0029970 Length:735 Species:Drosophila melanogaster
Sequence 2:NP_001100217.2 Gene:Nek9 / 299204 RGDID:1307187 Length:976 Species:Rattus norvegicus


Alignment Length:300 Identity:110/300 - (36%)
Similarity:160/300 - (53%) Gaps:29/300 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 AGMDFSQKTLQDYEVLAVMGNGSFGTCYKVRDKSTGELFAWKGMNYDELDEAKCDALVSEISVLR 71
            ||....|:.|. |..:.|:|.|:||.....|......|..||.::...|.|.:....::||.:|.
  Rat    40 AGGAAEQEELH-YIPIRVLGRGAFGEATLYRRTEDDSLVVWKEVDLTRLSEKERRDALNEIVILA 103

  Fly    72 QLQHPNIVQYYHHLVNREAKSVYIVMECCAGGDLAQIVQRARSQRQRFEEPYIWRVLFQLCRALQ 136
            .|||.||:.||:|.::.  .::.|.:|.|.||:|...:.|.:.  :.|||..:...|||:..|:.
  Rat   104 LLQHDNIIAYYNHFMDN--TTLLIELEYCNGGNLYDKILRQKD--KLFEEEMVVWYLFQIVSAVS 164

  Fly   137 VCHNKIPNGTILHRDIKPANIFLDAAGNAKLGDFGLARMLRRDQSFAASFVGTPHYMSPELVKGR 201
            ..|    ...|||||||..||||..|...||||:|||:.|..:.|.|.:.||||:||||||.:|.
  Rat   165 CIH----KAGILHRDIKTLNIFLTKANLIKLGDYGLAKKLNSEYSMAETLVGTPYYMSPELCQGV 225

  Fly   202 KYDRKSDVWAVGCLVYEMCALRPPFRGRAFD-----QLSEKIAQGEFSRIPAI------YSTDLQ 255
            ||:.|||:|||||:::|:..|:     |.||     .|..||.||    |.|:      ||..|.
  Rat   226 KYNFKSDIWAVGCVIFELLTLK-----RTFDATNPLNLCVKIVQG----IRAMEVDSSQYSLGLI 281

  Fly   256 EIIAFMLAVDHEQRPGIEVIIRHPLVVRNISELDGKFPIL 295
            :::...|..|.|:||..:.::..||:.:...|::.|..:|
  Rat   282 QLVHACLDQDPERRPTADALLDLPLLRKRRREMEEKVTLL 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nek2NP_572415.1 STKc_Nek2 18..281 CDD:270857 102/273 (37%)
S_TKc 19..281 CDD:214567 102/272 (38%)
Nek9NP_001100217.2 STKc_Nek9 50..297 CDD:270860 100/264 (38%)
ATS1 344..687 CDD:227511
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.