DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nek2 and Rcbtb2

DIOPT Version :9

Sequence 1:NP_572415.1 Gene:Nek2 / 31696 FlyBaseID:FBgn0029970 Length:735 Species:Drosophila melanogaster
Sequence 2:XP_038949091.1 Gene:Rcbtb2 / 290363 RGDID:735048 Length:585 Species:Rattus norvegicus


Alignment Length:88 Identity:18/88 - (20%)
Similarity:37/88 - (42%) Gaps:9/88 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 GMDFSQKTLQDYEVLAVMGNG----SFGT-CYKVRDKSTGELFAWKGMNYDELDEAKCDALVSEI 67
            |:...|.|::...:.::.|..    |:|: .:.|...:.||:|.|....|.:|.....:..:...
  Rat   113 GVGDIQSTIEPRRLDSLTGKKIASLSYGSGPHIVLATTDGEVFTWGHNAYSQLGNGTTNHGLVPC 177

  Fly    68 SVLRQLQHPNIVQY----YHHLV 86
            .:...|.:..:::.    ||.||
  Rat   178 HISTNLSNKQVIEVACGSYHSLV 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nek2NP_572415.1 STKc_Nek2 18..281 CDD:270857 15/78 (19%)
S_TKc 19..281 CDD:214567 15/77 (19%)
Rcbtb2XP_038949091.1 ATS1 <141..421 CDD:227511 12/60 (20%)
BTB_POZ_RCBTB2_CHC1L 408..524 CDD:349663
BACK_RCBTB2 521..585 CDD:350604
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.