powered by:
Protein Alignment Nek2 and Sergef
DIOPT Version :9
Sequence 1: | NP_572415.1 |
Gene: | Nek2 / 31696 |
FlyBaseID: | FBgn0029970 |
Length: | 735 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_006541006.1 |
Gene: | Sergef / 27414 |
MGIID: | 1351630 |
Length: | 465 |
Species: | Mus musculus |
Alignment Length: | 39 |
Identity: | 13/39 - (33%) |
Similarity: | 19/39 - (48%) |
Gaps: | 4/39 - (10%) |
- Green bases have known domain annotations that are detailed below.
Fly 17 QDYEVLAVMGNGSFGTCYKVRDKSTGELFAWKGMNYDEL 55
||.:|.||.. |..:.|....||::|.|...:|.:|
Mouse 264 QDEKVTAVWS----GWTHLVAKTETGKVFTWGRADYGQL 298
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1062377at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.010 |
|
Return to query results.
Submit another query.