DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nek2 and nekl-3

DIOPT Version :9

Sequence 1:NP_572415.1 Gene:Nek2 / 31696 FlyBaseID:FBgn0029970 Length:735 Species:Drosophila melanogaster
Sequence 2:NP_510080.2 Gene:nekl-3 / 181398 WormBaseID:WBGene00008956 Length:302 Species:Caenorhabditis elegans


Alignment Length:264 Identity:87/264 - (32%)
Similarity:144/264 - (54%) Gaps:24/264 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 MGNGSFGTCYKVRDKSTGELFAWKGMN--------YDELDEAKCDALVSEISVLRQLQHPNIVQY 81
            :|.|.|...::.:       ..|..::        ::.:|:......:.||.:|:||.|.|:::|
 Worm    29 IGKGQFSEVFRAQ-------CTWVDLHVALKKIQVFEMVDQKARQDCLKEIDLLKQLNHVNVIRY 86

  Fly    82 YHHLVNREAKSVYIVMECCAGGDLAQIVQRARSQRQRFEEPYIWRVLFQLCRALQVCHNKIPNGT 146
            |...::.  ..:.||:|....||::::::..:...:...|..||:...||.|||...|:|    .
 Worm    87 YASFIDN--NQLNIVLELAEAGDMSRMIKHFKKGGRLIPEKTIWKYFVQLARALAHMHSK----R 145

  Fly   147 ILHRDIKPANIFLDAAGNAKLGDFGLARMLRRDQSFAASFVGTPHYMSPELVKGRKYDRKSDVWA 211
            |:||||||||:|:...|..||||.||.|......:.|.|.||||:|||||.::...|:.|||:|:
 Worm   146 IMHRDIKPANVFITGNGIVKLGDLGLGRFFSSKTTAAHSLVGTPYYMSPERIQESGYNFKSDLWS 210

  Fly   212 VGCLVYEMCALRPPFRGRAFD--QLSEKIAQGEFSRIPA-IYSTDLQEIIAFMLAVDHEQRPGIE 273
            .|||:|||.||:.||.|...:  .|.:||...|:..:|| ||||.|:::::..:..:..:||...
 Worm   211 TGCLLYEMAALQSPFYGDKMNLYSLCKKIENCEYPPLPADIYSTQLRDLVSRCILPEASKRPETS 275

  Fly   274 VIIR 277
            .:::
 Worm   276 EVLQ 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nek2NP_572415.1 STKc_Nek2 18..281 CDD:270857 87/264 (33%)
S_TKc 19..281 CDD:214567 87/264 (33%)
nekl-3NP_510080.2 STKc_Nek6_7 23..283 CDD:270863 87/264 (33%)
S_TKc 23..279 CDD:214567 87/262 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000168
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R445
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.