DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nek2 and T07F12.4

DIOPT Version :9

Sequence 1:NP_572415.1 Gene:Nek2 / 31696 FlyBaseID:FBgn0029970 Length:735 Species:Drosophila melanogaster
Sequence 2:NP_001368727.1 Gene:T07F12.4 / 180763 WormBaseID:WBGene00020324 Length:329 Species:Caenorhabditis elegans


Alignment Length:282 Identity:78/282 - (27%)
Similarity:129/282 - (45%) Gaps:36/282 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 DFSQKTL---QDYEVL----AVMGNGSFGTCYKVRDKSTGELFAWKGMNYDELDEAKCDALVSEI 67
            ||:.|.:   :.||.:    |::|.|:||..:|...|.:....|.|.|       .|.....||:
 Worm    44 DFTNKQIILDEKYEYMDSVDAMIGMGAFGAVFKGSLKDSSNSIAIKRM-------LKVHVKESEL 101

  Fly    68 SVLRQLQHPNIVQYYHHLVNREAKSVYIVMECCAGGDLAQIVQRARSQRQRFEEPYIWRVLFQLC 132
            .::::|....:|... .:.|.:.....::||.| ..||...: |..|.:.|........:|..:.
 Worm   102 KMIKELNSEYLVGVL-DICNFDDFFCCLIMELC-DCDLDHHM-RNISVKGRLNPSNFRLLLDNIA 163

  Fly   133 RALQVCHNKIPNGTILHRDIKPANI---FLDAAGN---AKLGDFGLARMLRRDQSFAASFVGTPH 191
            |..:..:..    .|:||||||.||   :.||:..   |::.|||::|.|..:.....:..||.:
 Worm   164 RGYKALYEL----KIVHRDIKPQNILITYTDASKQIACARITDFGISRTLDNEGEELCNVAGTFY 224

  Fly   192 YMSPE----LVKGRKYDRKSDVWAVGCLVYEMCALRPPFRGRAFDQLSEKIAQGEFS-----RIP 247
            ||:||    |:|..:||.|.|:|::|||:|:......||...:..:|...:|...|.     .:|
 Worm   225 YMAPEVGANLLKTCQYDSKVDMWSIGCLLYQCVTGEVPFDECSLCKLFLYVAGANFDAYDPPELP 289

  Fly   248 AIYSTDLQEIIAFMLAVDHEQR 269
            ...|.::..||..:|.:|..||
 Worm   290 DELSQEVSGIIQSLLQLDTTQR 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nek2NP_572415.1 STKc_Nek2 18..281 CDD:270857 75/271 (28%)
S_TKc 19..281 CDD:214567 75/270 (28%)
T07F12.4NP_001368727.1 S_TKc 66..316 CDD:214567 72/260 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160157634
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.