DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nek2 and herc-1

DIOPT Version :9

Sequence 1:NP_572415.1 Gene:Nek2 / 31696 FlyBaseID:FBgn0029970 Length:735 Species:Drosophila melanogaster
Sequence 2:NP_490834.1 Gene:herc-1 / 171700 WormBaseID:WBGene00021685 Length:1019 Species:Caenorhabditis elegans


Alignment Length:258 Identity:53/258 - (20%)
Similarity:89/258 - (34%) Gaps:86/258 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 LQHPNIVQYYHHLVNREAKSVYIVMECCAGGD--LAQIVQRARSQRQRFEEPYIWRVLFQLCRAL 135
            :|..:::...:|::..|   .:.:.|.....|  |..:::..|....:.|..|.....|.|    
 Worm   570 MQKLSLINKTYHIIPLE---TFYIDELNTSVDLKLEYVLELTRQDPNKTELDYWTHFPFLL---- 627

  Fly   136 QVCHNKIPNGTILHRDIKPANIFLDAAGNAKLGDFGLARMLRRDQSFAASFVGTPHYMSPELVKG 200
                |.:..|.:         ||::|         .|.:.|||.    :|...|.|         
 Worm   628 ----NGVAKGEL---------IFVEA---------WLMQTLRRQ----SSLFNTAH--------- 657

  Fly   201 RKYDRKSDVWAVGCLVYEMCALRPPFRGRAFDQLSEKIAQGEFSRIPAIYSTDLQEIIAFMLA-V 264
                        |.:::|:..|....|       .|.|.....:::..:..:|||:.:...:| .
 Worm   658 ------------GTIIFELPHLELTVR-------REFIVSDTMNQMAGLSESDLQKPLKVNIAGE 703

  Fly   265 DHEQRPGI--EVIIRHPLVVRNISELD-GKFPILVDSGED-------FYTLPSGARLFEDEEE 317
            |.:...|:  |..|   ||:|.|.:.| |.|      .||       |..|||.   |.|.|:
 Worm   704 DADDAGGVRKEFFI---LVMRKILQSDYGMF------SEDEESHLVWFSGLPSE---FCDREQ 754

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nek2NP_572415.1 STKc_Nek2 18..281 CDD:270857 37/212 (17%)
S_TKc 19..281 CDD:214567 37/212 (17%)
herc-1NP_490834.1 ATS1 2..359 CDD:227511
HECTc 667..1016 CDD:238033 28/107 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.