DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nek2 and nek8

DIOPT Version :9

Sequence 1:NP_572415.1 Gene:Nek2 / 31696 FlyBaseID:FBgn0029970 Length:735 Species:Drosophila melanogaster
Sequence 2:NP_620776.1 Gene:nek8 / 171094 ZFINID:ZDB-GENE-020509-1 Length:697 Species:Danio rerio


Alignment Length:274 Identity:98/274 - (35%)
Similarity:156/274 - (56%) Gaps:10/274 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LQDYEVLAVMGNGSFGTCYKVRDKSTGELFAWKGMNYDELDEAKCDALVSEISVLRQLQHPNIVQ 80
            ::.||...|:|.|:||..:..|.::...|...|.:..:::...:..|..:|..||:.|.||||::
Zfish     1 MEKYEKTKVVGRGAFGIVHLCRRRTDSALVILKEIPVEQMTRDERLAAQNECQVLKLLSHPNIIE 65

  Fly    81 YYHHLVNREAKSVYIVMECCAGGDLAQIVQRARSQRQRFEEPYIWRVLFQLCRALQVCHNKIPNG 145
            ||.:.:  |.|::.|.||...||.||..:|:..:  ...:|..|.....|:..||...|||:   
Zfish    66 YYENFL--EDKALMIAMEYAPGGTLADYIQKRCN--SLLDEDTILHSFVQILLALYHVHNKL--- 123

  Fly   146 TILHRDIKPANIFLDAAGN-AKLGDFGLARMLRRDQSFAASFVGTPHYMSPELVKGRKYDRKSDV 209
             |||||:|..||.||.... .|:||||::::| ..:|.|.:.||||.|:||||.:|:.|::|||:
Zfish   124 -ILHRDLKTQNILLDKHQMIVKIGDFGISKIL-VSKSKAYTVVGTPCYISPELCEGKPYNQKSDI 186

  Fly   210 WAVGCLVYEMCALRPPFRGRAFDQLSEKIAQGEFSRIPAIYSTDLQEIIAFMLAVDHEQRPGIEV 274
            ||:||::||:.:|:..|.......|..||..|.|:.|...||.:|:::|..||.:|..:||.:..
Zfish   187 WALGCVLYELASLKRAFEAANLPALVLKIMSGTFAPISDRYSPELRQLILNMLNLDPSKRPQLNE 251

  Fly   275 IIRHPLVVRNISEL 288
            |:.|.:.:|.:..|
Zfish   252 IMAHAICIRPLLNL 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nek2NP_572415.1 STKc_Nek2 18..281 CDD:270857 96/263 (37%)
S_TKc 19..281 CDD:214567 96/262 (37%)
nek8NP_620776.1 STKc_Nek8 3..258 CDD:270859 96/263 (37%)
S_TKc 4..255 CDD:214567 95/259 (37%)
ATS1 309..662 CDD:227511
RCC1 1 417..468
RCC1 2 469..520
RCC1 3 521..586
RCC1 4 587..636
RCC1 5 637..689
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 1 1.000 - - FOG0000168
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R445
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.