DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nek2 and NEK10

DIOPT Version :9

Sequence 1:NP_572415.1 Gene:Nek2 / 31696 FlyBaseID:FBgn0029970 Length:735 Species:Drosophila melanogaster
Sequence 2:NP_001381899.1 Gene:NEK10 / 152110 HGNCID:18592 Length:1172 Species:Homo sapiens


Alignment Length:663 Identity:169/663 - (25%)
Similarity:283/663 - (42%) Gaps:141/663 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 KTLQDYEVLAVMGNGSFGTCYKVRDKSTGELFAWKGMNY-------DELD-EAKCDALVSEISVL 70
            |.:.:|.:|..:|:|:||..||||..|...|.|.|.:|.       |:.| ::....:|||::::
Human   514 KYIGNYAILDHLGSGAFGCVYKVRKHSGQNLLAMKEVNLHNPAFGKDKKDRDSSVRNIVSELTII 578

  Fly    71 R-QLQHPNIVQYYHHLVNREAKSVYIVMECCAGGDLAQIVQRARSQRQRFEEPYIWRVLFQLCRA 134
            : ||.|||||:||...:  |...:|||||...|..|.:.....:.:...|.|..:|::..|||.|
Human   579 KEQLYHPNIVRYYKTFL--ENDRLYIVMELIEGAPLGEHFSSLKEKHHHFTEERLWKIFIQLCLA 641

  Fly   135 LQVCHNKIPNGTILHRDIKPANIFLDAAGNAKLGDFGLARMLRRDQSFAASFVGTPHYMSPELVK 199
            |:..|.:   ..|:|||:.|.||.|.......:.|||||:. :::.|...|.|||..|..||::|
Human   642 LRYLHKE---KRIVHRDLTPNNIMLGDKDKVTVTDFGLAKQ-KQENSKLTSVVGTILYSCPEVLK 702

  Fly   200 GRKYDRKSDVWAVGCLVYEMCALRPPFRGRAFDQLSEKIAQGEFSRIP-AIYSTDLQEIIAFMLA 263
            ...|..|:|||||||::|:|..|.|||.......|:.||.:..:..:| .|||..:.:.|:..|.
Human   703 SEPYGEKADVWAVGCILYQMATLSPPFYSTNMLSLATKIVEAVYEPVPEGIYSEKVTDTISRCLT 767

  Fly   264 VDHEQRPGI--------EVIIRHPLVVRNIS----ELDGKFPILVDSGEDFYTLPSGARLFEDEE 316
            .|.|.||.|        :|::::   :.|:|    .|:.|.     ..|...|    .|.|.:..
Human   768 PDAEARPDIVEVSSMISDVMMKY---LDNLSTSQLSLEKKL-----ERERRRT----QRYFMEAN 820

  Fly   317 EDGV--HPELSSTMFTEQYSFNEGYGQRRLSVTGVFTPDLRSELFYSAKRKIFPAKKLQ------ 373
            .:.|  |.||:...       :|.:.:..||.:......|:|||..||.   .|.:..|      
Human   821 RNTVTCHHELAVLS-------HETFEKASLSSSSSGAASLKSELSESAD---LPPEGFQASYGKD 875

  Fly   374 --------LSDPSL-YESIRREERAE-ERQVELAEERRRKKDQ-------------------EQQ 409
                    |||.:. .|:..::..:| :.::::::........                   |:|
Human   876 EDRACDEILSDDNFNLENAEKDTYSEVDDELDISDNSSSSSSSPLKESTFNILKRSFSASGGERQ 940

  Fly   410 KRDQELLKEAPSSPR-ALTQNIFDEVLKTRLHAIRAQESLLQQKLEELQTREQE----------- 462
            .:.::......|.|| ||..  .|.:||...|.:||.   :::...||.|..|.           
Human   941 SQTRDFTGGTGSRPRPALLP--LDLLLKVPPHMLRAH---IKEIEAELVTGWQSHSLPAVILRNL 1000

  Fly   463 -----------------LQLAEQRVQTLERQMQEKLLQQEKHTCSCRQPIAPPIPPRKPAKSHHD 510
                             :.:::::|:.:...:|:.|:|..|.....:.|         || .||:
Human  1001 KDHGPQMGTFLWQASAGIAVSQRKVRQISDPIQQILIQLHKIIYITQLP---------PA-LHHN 1055

  Fly   511 DTYCTIELNETSPTVAKLNLATLPAPKSLNTLRKVTFKSPQ----KFVTYGIENMPPPAVKPAVN 571
            .....||..:.|....:.|...|.     :.::|::..||:    .|.|.....:...:...:::
Human  1056 LKRRVIERFKKSLFSQQSNPCNLK-----SEIKKLSQGSPEPIEPNFFTADYHLLHRSSGGNSLS 1115

  Fly   572 P-PPTGVPMQMSV 583
            | .|||:|..:.:
Human  1116 PNDPTGLPTSIEL 1128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nek2NP_572415.1 STKc_Nek2 18..281 CDD:270857 98/280 (35%)
S_TKc 19..281 CDD:214567 98/279 (35%)
NEK10NP_001381899.1 ARM 209..251
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 855..875 7/22 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 898..954 4/55 (7%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.