DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nek2 and RCC1

DIOPT Version :9

Sequence 1:NP_572415.1 Gene:Nek2 / 31696 FlyBaseID:FBgn0029970 Length:735 Species:Drosophila melanogaster
Sequence 2:NP_001041659.1 Gene:RCC1 / 1104 HGNCID:1913 Length:452 Species:Homo sapiens


Alignment Length:313 Identity:64/313 - (20%)
Similarity:109/313 - (34%) Gaps:67/313 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 GELFAWKGMNYDE-----LDEAKCDALVSEISVLRQLQHP--NIVQYYHHLVNREAKSVYIVMEC 99
            |.:|.|.....:.     |:..|    .|.:.|..||..|  .:.....|||...|......:.|
Human   169 GRVFLWGSFRDNNGVIGLLEPMK----KSMVPVQVQLDVPVVKVASGNDHLVMLTADGDLYTLGC 229

  Fly   100 CAGGDLAQIVQ--RARSQRQRFEEPYIWRVLFQLCRALQVCHNKIPNGTILHRDIKPANIFLDAA 162
            ...|.|.::.:  ..|..||..|     |:|...|..|:   ::...|.:..:|......|..|.
Human   230 GEQGQLGRVPELFANRGGRQGLE-----RLLVPKCVMLK---SRGSRGHVRFQDAFCGAYFTFAI 286

  Fly   163 GN-AKLGDFGLARMLRRDQSFAASFVGTPHYMS---PELVKGRKYDRKSDVWAVGCLVYEMCALR 223
            .: ..:..|||:...:         :|||...|   |:.:...|...||.|...|...:.:|.  
Human   287 SHEGHVYGFGLSNYHQ---------LGTPGTESCFIPQNLTSFKNSTKSWVGFSGGQHHTVCM-- 340

  Fly   224 PPFRGRAF-------------DQLSEKIAQGEFSRIPAIYS-----------TDLQEIIAFMLAV 264
             ...|:|:             :...||......||:||:.|           |....:.|:.:..
Human   341 -DSEGKAYSLGRAEYGRLGLGEGAEEKSIPTLISRLPAVSSVACGASVGYAVTKDGRVFAWGMGT 404

  Fly   265 DHEQRPGIEVIIRHPLVVRNISELDGKFPILVDSGEDFYTLPSGARLFEDEEE 317
            :::...|.:.....|:.:.. .:|:.:..:.|.||.....|     |.:|:|:
Human   405 NYQLGTGQDEDAWSPVEMMG-KQLENRVVLSVSSGGQHTVL-----LVKDKEQ 451

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nek2NP_572415.1 STKc_Nek2 18..281 CDD:270857 56/275 (20%)
S_TKc 19..281 CDD:214567 56/275 (20%)
RCC1NP_001041659.1 RCC1 66..113 CDD:278826
RCC1 116..165 CDD:278826
RCC1 168..218 CDD:278826 13/52 (25%)
RCC1 221..286 CDD:278826 14/72 (19%)
RCC1 289..340 CDD:278826 13/59 (22%)
RCC1 343..386 CDD:278826 9/42 (21%)
RCC1 394..445 CDD:278826 8/56 (14%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.