DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nek2 and si:ch73-122k23.1

DIOPT Version :9

Sequence 1:NP_572415.1 Gene:Nek2 / 31696 FlyBaseID:FBgn0029970 Length:735 Species:Drosophila melanogaster
Sequence 2:XP_021333767.1 Gene:si:ch73-122k23.1 / 101885338 ZFINID:ZDB-GENE-160113-35 Length:347 Species:Danio rerio


Alignment Length:131 Identity:31/131 - (23%)
Similarity:53/131 - (40%) Gaps:40/131 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   240 QGEFSRIPAIYSTDLQEIIAFMLAVDHEQRPGIEVIIRHPLVVRNISELDGKFPILVDSGEDFYT 304
            :|....|...||.:|:|:|:.||:.|.:.||..|.|:|.              |.|.::.:.|..
Zfish    20 KGTIPHISESYSKELRELISQMLSCDPKDRPSAEEILRR--------------PFLREAVKRFKR 70

  Fly   305 LPSGARLFEDEEEDGVHPELSSTMFTEQYSFN--------EGYGQRRLSVTGVFTPDLRSELFYS 361
            :|.|.       |..:...:::  |.|.|:.|        :.:|:         |.|...::.||
Zfish    71 IPEGL-------EQSLKKSINA--FVEAYNDNYKDFEVLVKEWGE---------TTDSLEDMHYS 117

  Fly   362 A 362
            |
Zfish   118 A 118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nek2NP_572415.1 STKc_Nek2 18..281 CDD:270857 15/40 (38%)
S_TKc 19..281 CDD:214567 15/40 (38%)
si:ch73-122k23.1XP_021333767.1 PKc_like <19..61 CDD:328722 16/54 (30%)
ApoL 33..297 CDD:310219 27/118 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.