DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nek2 and LOC100536575

DIOPT Version :9

Sequence 1:NP_572415.1 Gene:Nek2 / 31696 FlyBaseID:FBgn0029970 Length:735 Species:Drosophila melanogaster
Sequence 2:XP_009295984.1 Gene:LOC100536575 / 100536575 -ID:- Length:409 Species:Danio rerio


Alignment Length:328 Identity:62/328 - (18%)
Similarity:96/328 - (29%) Gaps:100/328 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   325 SSTMFTEQYSFNEGYGQ-RRLSVTGVFTPDLRSELFYSAKRKIFPAKKLQLSDPSLYESIRREER 388
            |.:|....:.|| |:|| .|..|:|.....:.|.:.              :||......:.|   
Zfish    31 SKSMSWFGFGFN-GFGQISRADVSGQVKCKVNSPVL--------------ISDDECKSGVNR--- 77

  Fly   389 AEERQVELAEERRRKKDQEQQKRDQEL--LKEAPSSPRALTQNIFDEVLKTRLHAIRAQESLLQQ 451
             .:|::......|....|.|......|  ....||:....:|...|.::.               
Zfish    78 -SDRRIRACWSSRADLQQTQSGSGVYLSGCVCGPSAQVCASQGCTDALIS--------------- 126

  Fly   452 KLEELQTREQELQLA-EQRVQTLE-RQMQEKLLQQEKHTCSCRQPIAPPI---------PPRKPA 505
                    |..|.|: ..||:..| :..|.:|:.:.:|..|.....|.|:         ||    
Zfish   127 --------ETHLTLSFTDRVELWEIKPQQNQLVWKREHELSAEHTAALPLVSGGFVQHKPP---- 179

  Fly   506 KSHHDDTYCTIELNETSPTVAKLN--------------------LATLPAPKSLNTLRKVTFKSP 550
             ..|....|.:.|...|.....|.                    |.:|..|:::..|..|    |
Zfish   180 -FFHPLKLCAVSLVLGSEHALLLTADGTLYSWGSGSHGQLGHGVLTSLEDPQAVEALWGV----P 239

  Fly   551 QKFVTYGIENMPPPAVKPA-------------VNPPPTGVPMQMSVSSNDSGDSQASSTRRKSIL 602
            .|.|..|  |....||...             :..|..|:..:....:....|.|..:|..||..
Zfish   240 IKAVAAG--NWHSAAVSSGGDLYMWGWNESGQLGLPSRGLEEEKRRGNGSGNDDQPINTDGKSRT 302

  Fly   603 SLF 605
            .:|
Zfish   303 DVF 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nek2NP_572415.1 STKc_Nek2 18..281 CDD:270857
S_TKc 19..281 CDD:214567
LOC100536575XP_009295984.1 RCC1_2 189..217 CDD:290274 3/27 (11%)
RCC1 204..253 CDD:278826 10/54 (19%)
RCC1_2 240..269 CDD:290274 6/30 (20%)
RCC1 257..336 CDD:278826 8/49 (16%)
RCC1_2 323..352 CDD:290274
RCC1 340..389 CDD:278826
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.