DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nek2 and stkld1

DIOPT Version :9

Sequence 1:NP_572415.1 Gene:Nek2 / 31696 FlyBaseID:FBgn0029970 Length:735 Species:Drosophila melanogaster
Sequence 2:XP_031746904.1 Gene:stkld1 / 100491915 XenbaseID:XB-GENE-996507 Length:608 Species:Xenopus tropicalis


Alignment Length:345 Identity:96/345 - (27%)
Similarity:159/345 - (46%) Gaps:49/345 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 GMDFSQKTLQDYEVLAVMGNGSFGTCYKVRDKSTGELFAWKGMNYDELDEAKCDALVSEISVLRQ 72
            |||       :|.:|...|.|:||....|.:......:..|  ..:.:||.:.:....|.:.|.:
 Frog    18 GMD-------NYRILEEWGPGTFGDACLVEELKGNTQYVIK--KVECMDEREANLAAGEAAPLLR 73

  Fly    73 LQHPNIVQYYHHLVNREAK--SVY--IVMECCAGGDLAQIVQRARSQRQRFEEPYIWRVLFQLCR 133
            |:||||..|....|..:.|  :::  :..:.||.||:|.:|:|.|.:.|..||..|..:|.|...
 Frog    74 LRHPNICAYREFFVTWDNKISALFFCLATDYCAHGDVAAMVRRNRQRVQNTEEKVIQVLLGQSIN 138

  Fly   134 ALQVCHNKIPNGTILHRDIKPANIFLDAAGNAKLGDFGLARMLRRDQSFAASFVGTPH--YMSPE 196
            ||...|.:    .:|||::||:||||.......:||. |...|..|:......:|...  :.:||
 Frog   139 ALIYIHQQ----NLLHRNLKPSNIFLKDESTFLIGDL-LPERLLSDEMRIEKRLGDEWRLWAAPE 198

  Fly   197 LVKGRKYDRKSDVWAVGCLVYEM--CALRPPFRGRAFDQL-----SEKIAQGEFSRIPAI----- 249
            .:. ..|..|||||::||::.|:  |:|   :.|.....|     :|.:..|:.  :|.:     
 Frog   199 AMT-LTYSEKSDVWSLGCVLLEVMSCSL---YTGEMVASLLREIRAEPLCVGKL--VPTLQAIGG 257

  Fly   250 YSTDLQEIIAFMLAVDHEQRPGIEVIIRHPLVVRNISELDGKFPILVDSGEDFYTLPSGARLFED 314
            |...|.:::..||.::.|:|.....::..|.|.:.::.:....     ||:. .||||||  ..:
 Frog   258 YPAGLCQLLPLMLQIEPEKRCTAIELVGVPYVKQCLALIGSTL-----SGQK-KTLPSGA--IAE 314

  Fly   315 EEEDGVHPELSSTMFTEQYS 334
            .||.||...|.   |.:::|
 Frog   315 LEEAGVEKTLE---FMQRHS 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nek2NP_572415.1 STKc_Nek2 18..281 CDD:270857 77/280 (28%)
S_TKc 19..281 CDD:214567 77/279 (28%)
stkld1XP_031746904.1 PKc_like 21..289 CDD:419665 77/280 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.