DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nek2 and herc3

DIOPT Version :9

Sequence 1:NP_572415.1 Gene:Nek2 / 31696 FlyBaseID:FBgn0029970 Length:735 Species:Drosophila melanogaster
Sequence 2:XP_002938676.3 Gene:herc3 / 100488790 XenbaseID:XB-GENE-968537 Length:1050 Species:Xenopus tropicalis


Alignment Length:338 Identity:62/338 - (18%)
Similarity:111/338 - (32%) Gaps:113/338 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 GEESAGMDFSQKTLQDYEVLAVMGN----------------GSFGTCYKVRDKSTGELFAWKGMN 51
            |....|.|.....:....||.:||:                .|.||.|.......|:|    |..
 Frog   270 GSGQLGHDSLNNEINPRRVLELMGSEVSQIACGRQHTLAFVPSSGTLYAFGCGDLGQL----GTG 330

  Fly    52 YDELDEAKCDALV--------SEISVLRQLQHPNIVQYYHHLVNREAKSVYIVMECCAGGDLAQI 108
            :.  :..||.|:|        .:||:     |.:...|            .||.:..:||:...:
 Frog   331 HK--NNVKCPAVVKGKWAAHSGQISM-----HADRAAY------------NIVKQIFSGGNKTFV 376

  Fly   109 VQRARSQRQRFEEPYIWRVLFQLCRALQVCHNKIPNGTILHRDIKPANIFLDAAGNAKLGDFGLA 173
            :.......|..::       |:.|.  |..|..:.|...:  |:....:..::..|:.   .|:.
 Frog   377 LCSKLESSQPADD-------FRFCS--QRNHTSVINEETI--DVWRQKVLENSNTNSM---NGIV 427

  Fly   174 RMLRRDQSFAASFV---GTPHYMSPELVKGRKYDRKSDVWAVGCLVYEMCALRPPFRGRAFDQLS 235
            :.|.....:..||:   ...|:.:...:.|                ..||:::..|         
 Frog   428 QTLSSLACWNGSFLEKRNDEHFRTSPKIPG----------------INMCSIKVLF--------- 467

  Fly   236 EKIAQGEFSRIPAIYSTDLQEII----AFMLAVDHEQRPGIEVIIRHPLVVRNISELDGKFPILV 296
            ||:.....||:       |::|:    :|::.......|.:|.:        .|..:..:||:|.
 Frog   468 EKLMNVHHSRL-------LEQILKGFESFLIPQLSSSPPDVEAM--------RIYIILPEFPLLQ 517

  Fly   297 DSGEDFY---TLP 306
            ||  .:|   |||
 Frog   518 DS--KYYITLTLP 528

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nek2NP_572415.1 STKc_Nek2 18..281 CDD:270857 49/293 (17%)
S_TKc 19..281 CDD:214567 49/292 (17%)
herc3XP_002938676.3 RCC1 3..49 CDD:395335
ATS1 44..353 CDD:227511 18/88 (20%)
HECTc 702..1048 CDD:238033
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.