DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nek2 and herc6

DIOPT Version :9

Sequence 1:NP_572415.1 Gene:Nek2 / 31696 FlyBaseID:FBgn0029970 Length:735 Species:Drosophila melanogaster
Sequence 2:XP_031759089.1 Gene:herc6 / 100487734 XenbaseID:XB-GENE-968556 Length:1030 Species:Xenopus tropicalis


Alignment Length:117 Identity:26/117 - (22%)
Similarity:45/117 - (38%) Gaps:21/117 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   402 RKKDQEQQKRDQELLKEAPSSPRALTQNIFDEVLKTRLHAIRAQESLLQQKLEELQTRE-----Q 461
            ||::.|:.:..::|:       |...|.|.|......||.|..:..||:..|.:|...|     :
 Frog   654 RKRNNEKFQAQEQLV-------RNRLQGISDLPNIPLLHLILRRGHLLEDTLHKLSIVEDPNLKK 711

  Fly   462 ELQLAEQRVQTLERQ---------MQEKLLQQEKHTCSCRQPIAPPIPPRKP 504
            :|.:..|...|.:..         :.|.::..:....||..|:.|...|..|
 Frog   712 DLLVEFQGESTTDSAAVTKEFFLVLLESMVNPDYGMFSCSDPLLPIWFPSTP 763

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nek2NP_572415.1 STKc_Nek2 18..281 CDD:270857
S_TKc 19..281 CDD:214567
herc6XP_031759089.1 ATS1 2..373 CDD:227511
HUL4 324..1021 CDD:227354 26/117 (22%)
HECTc 684..1028 CDD:238033 18/80 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.