DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nek2 and Rcc1

DIOPT Version :9

Sequence 1:NP_572415.1 Gene:Nek2 / 31696 FlyBaseID:FBgn0029970 Length:735 Species:Drosophila melanogaster
Sequence 2:NP_001184011.1 Gene:Rcc1 / 100088 MGIID:1913989 Length:434 Species:Mus musculus


Alignment Length:87 Identity:20/87 - (22%)
Similarity:31/87 - (35%) Gaps:18/87 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   561 MPPPAVKPAVNPPPTGVPMQMSV-SSNDSGDSQAS--------STRRKSILSL-------FGLSR 609
            |||..:....:||...:|....| .:.:.|.:..|        :|....:|:|       .||..
Mouse     1 MPPKRIAKRRSPPEDAIPKSKKVKDTRNRGPATRSCQVSHRSHNTEPGLVLTLGQGDVGQLGLGE 65

  Fly   610 GSKATSKS--LPSVNQVAQAAA 629
            ......|.  :|.:..|.||.|
Mouse    66 SVLERKKPALVPLLQDVVQAEA 87

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nek2NP_572415.1 STKc_Nek2 18..281 CDD:270857
S_TKc 19..281 CDD:214567
Rcc1NP_001184011.1 RCC1 48..95 CDD:278826 10/40 (25%)
RCC1 98..147 CDD:278826
RCC1 150..200 CDD:278826
RCC1_2 187..216 CDD:290274
RCC1 203..268 CDD:278826
RCC1 271..322 CDD:278826
RCC1 325..368 CDD:278826
RCC1 376..427 CDD:278826
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.