DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nek2 and herc5.3

DIOPT Version :9

Sequence 1:NP_572415.1 Gene:Nek2 / 31696 FlyBaseID:FBgn0029970 Length:735 Species:Drosophila melanogaster
Sequence 2:XP_021330683.1 Gene:herc5.3 / 100073325 ZFINID:ZDB-GENE-070615-14 Length:1002 Species:Danio rerio


Alignment Length:582 Identity:109/582 - (18%)
Similarity:192/582 - (32%) Gaps:215/582 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 NGSFGTCYKVRDKSTGELFAWKGMNYD-------ELDEAKCDALVSE-ISVLRQLQHPNIVQYYH 83
            ||||  ....||:.........|:::|       :|..:|  :|:|| :.|::|...|::   ..
Zfish   405 NGSF--LKTSRDEHYQTSVERCGLDFDLVKTSFAKLSTSK--SLISEVVKVVQQTLLPSL---NP 462

  Fly    84 HLVNREAKSVYIVMECCAGGDLAQIVQRARSQRQRFEEPYIWRVLFQLC----RALQVCHNKIPN 144
            :....||..:|::        |.:::...:.||.:..|...:::| :||    :.|::..:::| 
Zfish   463 NPTGEEALRLYLL--------LPELINGLKKQRTKLIEALAFKIL-ELCPAARKVLEMYWSRLP- 517

  Fly   145 GTILHRDIKPANIFLDAAGNAKLGDFGLARMLRRDQSFAASFVGTPHYMSPELVK----GRKYDR 205
                                              |..|.| .:...|..|.||:|    |...|:
Zfish   518 ----------------------------------DDWFEA-LIKLFHKESAELIKQISRGETDDQ 547

  Fly   206 KS----DVWAVGCLVYEMCALRPPFRGRAFDQLSEKIAQGEFSRIPAIYSTDLQEII-------- 258
            .:    :...:..:.|::|.             |..|...:|. ||.:  .||.|.:        
Zfish   548 STRHLKNFLEILQMAYQICC-------------STNITNHDFI-IPEV--NDLLETLDATSAEVL 596

  Fly   259 --AFMLAVDHEQRPGI----------EVIIRHPLVVRNISELDGKFPILVDSGEDFYTLPSGARL 311
              |..|.::.|....:          |::::.|.|                  .||.|..|...|
Zfish   597 WMASRLPINEELHNRMKLEDYYFKTAEILVKFPFV------------------SDFLTKKSMFIL 643

  Fly   312 FEDE--------------------EEDGVHPELSSTM-----FTEQYSFNEGYGQRRLSVTGVFT 351
            .:::                    ..:.|   |:.|:     ||  |||     ...|.|..:..
Zfish   644 LQEQCIRSLLDLLVVHLNGNLLHINRESV---LTDTLQYLRPFT--YSF-----MHPLQVAFIGE 698

  Fly   352 PDLRSEL----FYSAKRKIF---PAKKLQLSDPSLYESIRREERAEERQVELAEERRRKKDQEQQ 409
            .::..::    |:|...|.|   ..|.|::.:.||...                    .....|.
Zfish   699 DEIDEKVISAEFFSLISKSFIEWDKKILEVHESSLVWF--------------------NPHHTQD 743

  Fly   410 KRDQELLKEAPSSPRALTQNIFDEVLKTRLH-----AIRAQESLLQQK--LEELQTREQELQLAE 467
            .||...|..           |....|..|.|     .:...:.|||||  |::|    :||...|
Zfish   744 HRDFYYLGV-----------ICGMALYNRHHINIDFPLALFKKLLQQKPSLDDL----EELSPVE 793

  Fly   468 QR-VQTLERQMQEKL--LQQEKHTCSCRQ--PIAPPIPPRKPAKSHHDDTYCTIELNETSPT 524
            .| ::.|..:.:|::  ||....||..::  |....|...|..:..:.|.|.....|::..|
Zfish   794 ARSLKNLLEEDEEEVVDLQHLDFTCKGQELVPNGSQIQVNKVNRQKYVDLYVDFVFNKSVKT 855

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nek2NP_572415.1 STKc_Nek2 18..281 CDD:270857 53/293 (18%)
S_TKc 19..281 CDD:214567 53/293 (18%)
herc5.3XP_021330683.1 RCC1 <74..349 CDD:332518
HECTc 665..1000 CDD:331829 50/236 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.