DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10932 and Acaa1a

DIOPT Version :9

Sequence 1:NP_001284987.1 Gene:CG10932 / 31695 FlyBaseID:FBgn0029969 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_036621.2 Gene:Acaa1a / 24157 RGDID:67379 Length:434 Species:Rattus norvegicus


Alignment Length:396 Identity:130/396 - (32%)
Similarity:211/396 - (53%) Gaps:26/396 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 AEVVVVSAARTPIG-SFQSQLAPLTATQLGARAIEAAIEKAGIAKTDVQEVIMGNVVSAGLGQAP 86
            ::||||...||||| :.:......|..:|.:..:.|.::...:....:.::.:|||:..|.|...
  Rat    46 SDVVVVHGRRTPIGRAGRGGFKDTTPDELLSAVLTAVLQDVKLKPECLGDISVGNVLEPGAGAVM 110

  Fly    87 ARQAAIFAGLPTNVCCTTVNKVCSSGMKAVMLGAQSLMLGYADVVVAGGMESMSNVPYYLKRGAT 151
            ||.|...:|:|..|..:.||:.||||::||...|..:..|..|:.:|.|:||||     |.....
  Rat   111 ARIAQFLSGIPETVPLSAVNRQCSSGLQAVANIAGGIRNGSYDIGMACGVESMS-----LSNRGN 170

  Fly   152 PYGGVN---LTDGIVFDGLWDVYNKFHMGNCAENTAKKLEITRQQQDDFAIESYKRSAAAWANKV 213
            | |.::   |......|.|      ..||..:||.|::..|:||:||.||:.|.:::|:|.:...
  Rat   171 P-GNISSRLLESDKARDCL------IPMGITSENVAERFGISRQKQDAFALASQQKAASAQSKGC 228

  Fly   214 FQDEIAPVKI----QQKRKPEIVISEDEEYK-RVNFDKFGQLATVFQRENGTVTAGNASTLNDGG 273
            |:.||.||..    .:..:..|.:|:||..: ....:...:|...| ::.|:.||||:|.::||.
  Rat   229 FRAEIVPVTTTVLDDKGDRKTITVSQDEGVRPSTTMEGLAKLKPAF-KDGGSTTAGNSSQVSDGA 292

  Fly   274 AAVVLMSAEAAQKAGIKPLARIVAFQDAETDPIDFPIAPALAIPKLLKRAGVRKEDVAMWEVNEA 338
            |||:|.....|::.|:..|..:.::......|....|.||.|||..|::||:...|:.::|:|||
  Rat   293 AAVLLARRSKAEELGLPILGVLRSYAVVGVPPDIMGIGPAYAIPAALQKAGLTVNDIDIFEINEA 357

  Fly   339 FSLVVLANIKKLDVDPAKVNVHGGAVSIGHPIGMSGARLVAHLSHSLK---KGELGCASICNGGG 400
            |:...|..::||.:...|||..|||:::|||:|.:|||.|..|.:.||   :...|..|:|.|.|
  Rat   358 FASQALYCVEKLGIPAEKVNPLGGAIALGHPLGCTGARQVVTLLNELKRRGRRAYGVVSMCIGTG 422

  Fly   401 -GASSI 405
             ||:::
  Rat   423 MGAAAV 428

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10932NP_001284987.1 PLN02644 24..410 CDD:215347 130/395 (33%)
thiolase 26..409 CDD:238383 129/393 (33%)
Acaa1aNP_036621.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0183
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D321628at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.