DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10932 and ACAA2

DIOPT Version :9

Sequence 1:NP_001284987.1 Gene:CG10932 / 31695 FlyBaseID:FBgn0029969 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_006102.2 Gene:ACAA2 / 10449 HGNCID:83 Length:397 Species:Homo sapiens


Alignment Length:393 Identity:146/393 - (37%)
Similarity:229/393 - (58%) Gaps:14/393 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 VVVVSAARTPIGSFQSQLAPLTATQLGARAIEAAIEKAGIAKTDVQEVIMGNVV-SAGLGQAPAR 88
            |.||:|.|||.|::...|...|||.|...|.:||:....::...|..||||||: |:......||
Human     7 VFVVAAKRTPFGAYGGLLKDFTATDLSEFAAKAALSAGKVSPETVDSVIMGNVLQSSSDAIYLAR 71

  Fly    89 QAAIFAGLPTNVCCTTVNKVCSSGMKAVMLGAQSLMLGYADVVVAGGMESMSNVPYYLK--RGAT 151
            ...:..|:|......|:|::|.||.::::.|.|.:.:..|:||:.||.||||..||.::  |..|
Human    72 HVGLRVGIPKETPALTINRLCGSGFQSIVNGCQEICVKEAEVVLCGGTESMSQAPYCVRNVRFGT 136

  Fly   152 PYGGVNLTDGIVFDGLW----DVYNKFHMGNCAENTAKKLEITRQQQDDFAIESYKRSAAAWANK 212
            ..|    :|..:.|.||    |.:.:..|...|||.|.|.:|:|::.|.:|::|.:|..||....
Human   137 KLG----SDIKLEDSLWVSLTDQHVQLPMAMTAENLAVKHKISREECDKYALQSQQRWKAANDAG 197

  Fly   213 VFQDEIAPVKIQQKRKPEIVISEDEEYKRVNFDKFGQLATVFQRENGTVTAGNASTLNDGGAAVV 277
            .|.||:||::::.|:..:.:..::....:...::..:|..||::: |||||||||.:.||..||:
Human   198 YFNDEMAPIEVKTKKGKQTMQVDEHARPQTTLEQLQKLPPVFKKD-GTVTAGNASGVADGAGAVI 261

  Fly   278 LMSAEAAQKAGIKPLARIVAFQDAETDPIDFPIAPALAIPKLLKRAGVRKEDVAMWEVNEAFSLV 342
            :.|.:|.:|....||||||.:..:..||....|.|..||...||:||:..:|:.:.||||||:..
Human   262 IASEDAVKKHNFTPLARIVGYFVSGCDPSIMGIGPVPAISGALKKAGLSLKDMDLVEVNEAFAPQ 326

  Fly   343 VLANIKKLDVDPAKVNVHGGAVSIGHPIGMSGARLVAHLSHSLKK--GELGCASICNGGGGASSI 405
            .||..:.||:|.:|.||:|||:::|||:|.||:|:.|||.|.|::  |:....|.|.|||...::
Human   327 YLAVERSLDLDISKTNVNGGAIALGHPLGGSGSRITAHLVHELRRRGGKYAVGSACIGGGQGIAV 391

  Fly   406 LIE 408
            :|:
Human   392 IIQ 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10932NP_001284987.1 PLN02644 24..410 CDD:215347 146/393 (37%)
thiolase 26..409 CDD:238383 145/392 (37%)
ACAA2NP_006102.2 thiolase 8..394 CDD:238383 144/390 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0183
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D321628at33208
OrthoFinder 1 1.000 - - FOG0000432
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.