DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir7g and grik5

DIOPT Version :9

Sequence 1:NP_001368933.1 Gene:Ir7g / 31694 FlyBaseID:FBgn0029968 Length:607 Species:Drosophila melanogaster
Sequence 2:NP_001315085.1 Gene:grik5 / 798791 ZFINID:ZDB-GENE-070821-6 Length:1067 Species:Danio rerio


Alignment Length:412 Identity:84/412 - (20%)
Similarity:151/412 - (36%) Gaps:99/412 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 GPRTHNLLLVDSLDALLDIEIHTYTAQSDTSEYYFIFLQQRDALIPHDMQGVFAYCWRH--QLIN 155
            ||...:.||.|::..::       :|..:.:....|.::......|.        .|:|  .|:|
Zfish   312 GPALSSALLFDAVHVVV-------SAVQELNRSQEIGVKPLSCTSPQ--------IWQHGTSLMN 361

  Fly   156 CNVMTQSSG--GQVLLHTYFPYAPGQCNDSQPTRINMFLGESWKHRD-------YFPSKLHNLNG 211
            ...|.:..|  |:|..            :|:..|.|..|....|||.       ::.:....:|.
Zfish   362 YLRMVEYDGLTGRVEF------------NSKGQRTNYTLHILEKHRGGHKEIGIWYSNNTLLMNS 414

  Fly   212 CPLIV-----LARK---VSPFLDLD-----------EGQRELRGLEGRLLQELSRRMNFSIQFSG 257
            ..|.:     ||.|   ::..|:..           ||..:..|....:|:|||..:.|:.:...
Zfish   415 TSLDINVSETLANKSLIITTILENPYVMRKINYQEFEGNEQYEGFCVDMLRELSDILKFTYRIKL 479

  Fly   258 LQDQL----KNRTTWTEK--QLLQKLVQERIAHLAIGYVRKRIQYATNLTPVFPHYSNRVVG-CL 315
            :.|.|    :...:||..  :|:.:.....:|...|...|:::   .:.:..|     ..:| .:
Zfish   480 VDDGLYGAPEPNGSWTGMVGELINRKADLAVAAFTITSEREKV---IDFSKPF-----MTLGISI 536

  Fly   316 LLNAHNLTSLEIWSF--PFQALTWICLVFSFLSISCLALLHXRGA-----------GDRLALVLA 367
            |...|.......:||  ||....|:.::.::|::||:..|..|.:           .:|..|:..
Zfish   537 LYRVHIGRKPGYFSFLDPFSPAVWLFMLLAYLAVSCVLFLSARLSPYEWYNPHPCLRERRDLLEN 601

  Fly   368 VYAA--SLGLPID---------PPERPSLQLLFASWLIFGLIVRSMYSALLFFIL---RYHLHQR 418
            .|..  ||..|:.         .|...|.:.:...|..|.||:.|.|:|.|...|   |..:...
Zfish   602 QYTLGNSLWFPVGGFMQQGSEIMPRALSTRCVSGVWWAFTLIIISSYTANLAAFLTVQRMEVPIE 666

  Fly   419 LPGNLQDLTHGDYAAVMGRTTL 440
            .|.:|.|.|:..|..:.|.:|:
Zfish   667 SPDDLADQTNIQYGTIHGGSTM 688

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir7gNP_001368933.1 None
grik5NP_001315085.1 PBP1_iGluR_Kainate_KA1_2 38..412 CDD:107389 23/126 (18%)
ANF_receptor 55..392 CDD:279440 20/106 (19%)
Periplasmic_Binding_Protein_Type_1 <313..383 CDD:299141 16/96 (17%)
Periplasmic_Binding_Protein_Type_2 427..797 CDD:304360 57/270 (21%)
Lig_chan 558..828 CDD:278489 31/131 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170591757
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.