DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir7g and gria1a

DIOPT Version :9

Sequence 1:NP_001368933.1 Gene:Ir7g / 31694 FlyBaseID:FBgn0029968 Length:607 Species:Drosophila melanogaster
Sequence 2:NP_991161.1 Gene:gria1a / 798689 ZFINID:ZDB-GENE-020125-1 Length:914 Species:Danio rerio


Alignment Length:430 Identity:79/430 - (18%)
Similarity:124/430 - (28%) Gaps:195/430 - (45%)


- Green bases have known domain annotations that are detailed below.


  Fly   204 SKLHNLNGCPLIVLARKVSPF---LDLDEGQRELR--GLEGRL-LQELSRRMNFSIQFSGL---- 258
            |:..|...|    ||...:|:   :|:....:::|  ||.|.: ..|..||.|:||....|    
Zfish   313 SRRGNAGEC----LANPPAPWGQGIDIQRALQQVRIEGLTGHIQFNEKGRRTNYSISVMELRPTG 373

  Fly   259 --------QDQ-----------------LKNR----TTWTEKQ--LLQK---------------- 276
                    :|:                 |:||    ||..|..  :|:|                
Zfish   374 PKKVGYWNEDEKFVSTAAYMPGSNETYGLQNRTYIVTTILESPYVMLKKNHEHFTGNDKYEGYCV 438

  Fly   277 -LVQERIAHLAIGYVRKRI---QYATNLTPVFPHYSNRVVGCLLLNAHN---------LTSLEIW 328
             |..|...|:...|:.|.:   :|........  ..|.:||.|:....:         |...|:.
Zfish   439 ELAAEIAKHVGYHYILKIVADGKYGARDAETM--MWNGMVGELVYGKADVAVAPLTITLVREEVI 501

  Fly   329 SF--PFQAL--------------------------TWICLVFSFLSISCLALLHXR--------- 356
            .|  ||.:|                          .|:|:||:::.:|.:..|. |         
Zfish   502 DFSKPFMSLGISIMIKKPTKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHAD 566

  Fly   357 --------------------------------------GAGDRLALVLAVYAASLGLPIDPPERP 383
                                                  |..:.|...|..:... |..|. |...
Zfish   567 DCEDGAEENPNQPSSSSAQPGQNQQNQNQQSQEQTNEFGIFNSLWFSLGAFMQQ-GCDIS-PRSL 629

  Fly   384 SLQLLFASWLIFGLIVRSMYSALLFFILRYHLHQRLPGNLQDLTHGDYAAVMGRTTLQDLREVPS 448
            |.:::...|..|.||:.|.|:|.|...|                          |..:.:..:.|
Zfish   630 SGRIVGGVWWFFTLIIISSYTANLAAFL--------------------------TVERMVSPIES 668

  Fly   449 LQDLLGLKSVIVTSEREEEVLRTLDRCTLREGAGSHPLFF 488
            .:||         :::.|....|||       |||...||
Zfish   669 AEDL---------AKQTEIAYGTLD-------AGSTKEFF 692

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir7gNP_001368933.1 None
gria1aNP_991161.1 Periplasmic_Binding_Protein_Type_1 26..387 CDD:299141 19/77 (25%)
ANF_receptor 36..369 CDD:279440 17/59 (29%)
PBP2_iGluR_AMPA_GluR1 404..806 CDD:270447 59/335 (18%)
Lig_chan 536..836 CDD:278489 36/201 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170591485
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.