DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir7g and grin2ab

DIOPT Version :9

Sequence 1:NP_001368933.1 Gene:Ir7g / 31694 FlyBaseID:FBgn0029968 Length:607 Species:Drosophila melanogaster
Sequence 2:XP_009304490.1 Gene:grin2ab / 570493 ZFINID:ZDB-GENE-070424-223 Length:1445 Species:Danio rerio


Alignment Length:435 Identity:74/435 - (17%)
Similarity:155/435 - (35%) Gaps:132/435 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   241 LLQELSRRMNFSIQF----SGLQDQLKNRTTWTEKQLLQKLVQERIAHLAIG--YVRKRIQYATN 299
            :|::::|.:.|:...    :|...: |....|  ..::.::|.:: |.:|:|  .:.:....|.:
Zfish   451 ILKKIARNVKFTYDLYLVTNGKHGK-KINNVW--NGMVGEVVYKK-AVMAVGSLTINEERSEAID 511

  Fly   300 LTPVFPHYSNRVVGCLLLNAHNLTSLEIWSFPFQALTWICLVFSFLSISCLALL----------- 353
            .:..|....   :..::..::...|...:..||.|..|:.:....|.::.:|:.           
Zfish   512 FSVPFVETG---ISVMVSRSNGTVSPSAFLEPFSASVWVMMFVMLLIVTAIAVFLFEFISPLGFN 573

  Fly   354 ---------HXRGAGDRLALVLAVY-----AASLGLPIDPPERPSLQLLFASWLIFGLIVRSMYS 404
                     |    |....:..||:     ..:..:|:..|...:.:.:.:.|..|.:|..:.|:
Zfish   574 RNLAQGKDPH----GPSFTIGKAVWLLWGLVFNNSVPVQNPRGTTSKFIVSVWAFFAVIFLASYT 634

  Fly   405 A-LLFFILRYHLHQRLPGNLQDLTHGD---------YAAVMGRTTLQDLRE-VPSLQDLL----- 453
            | |..|:::.....::.| |.|.....         :..|...:|.:::|: .|::...:     
Zfish   635 ANLAAFMIQEEFVDQVTG-LSDRKFQSPYSYSPPFRFGTVPNGSTERNIRKNYPAMHQYMVKYHQ 698

  Fly   454 -GLKSVIVTSER--------EEEVLRTL----DRCTLREGAGSHPLF----FGLISQDA-----L 496
             |:...:|:.:.        :..||..:    |.|.| ...||..:|    :|:..|..     |
Zfish   699 TGVVDALVSLKTGKLDAFIYDAAVLNYMAGRDDGCKL-VTIGSGYIFATTGYGIAMQKGSYWKRL 762

  Fly   497 LHLTQRGHRAGAYHIIPQDVLEQQLAIYL------QKHSHLASHLDHLVMSIRSVGLVHHWAGQM 555
            :.|...|       ||....:|:..|.:|      :|:..::|.||           |.:.||  
Zfish   763 VDLAILG-------IIGDGEMEELEAQWLTGICHNEKNEVMSSQLD-----------VDNMAG-- 807

  Fly   556 ASERYFRSRFLYREKRIRQPDLWAVYILTAGLYLLSLVVFICELL 600
                                    |:.:.|....|||:.|:.|.|
Zfish   808 ------------------------VFYMLAAAMALSLITFVWEHL 828

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir7gNP_001368933.1 None
grin2abXP_009304490.1 PBP1_iGluR_NMDA_NR2 25..382 CDD:107373
ANF_receptor 48..358 CDD:279440
PBP2_iGluR_NMDA_Nr2 393..790 CDD:270436 59/358 (16%)
Lig_chan 544..816 CDD:278489 52/321 (16%)
NMDAR2_C 827..1445 CDD:287527 1/2 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170591460
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.