DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir7g and grin2da

DIOPT Version :9

Sequence 1:NP_001368933.1 Gene:Ir7g / 31694 FlyBaseID:FBgn0029968 Length:607 Species:Drosophila melanogaster
Sequence 2:XP_009292354.1 Gene:grin2da / 449864 ZFINID:ZDB-GENE-041008-124 Length:1916 Species:Danio rerio


Alignment Length:263 Identity:46/263 - (17%)
Similarity:92/263 - (34%) Gaps:73/263 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   178 GQC-NDSQPTRI---NMFLGESWKHRDYFPSKLHNLNGCPLIVLAR--KVSPF---LDLDEGQRE 233
            |.| .||.|.|:   |..:.|.      ..|..|...|..:.||.|  |:..|   |.|....|.
Zfish   476 GSCIRDSVPCRLPLNNSMVVEG------IQSMKHCCKGFCIDVLKRLAKIVGFTYDLYLVTNGRH 534

  Fly   234 LRGLEGRLLQELSRRMNFSIQFSGLQDQLKNRTTWTEKQLLQKLVQERIAHLAIGYV---RKRIQ 295
            .:.::|              |::|               ::.::|.:| |.:|||.:   .:|.:
Zfish   535 GKNIDG--------------QWNG---------------MVGEVVSKR-ADMAIGSLTINEERSE 569

  Fly   296 YATNLTPVFPHYSNRVVGCLLLNAHNLTSLEIWSFPFQALTWICLVFSFLSISCLALL------- 353
            ......|    :....:..::..::...|...:..|:....|:.:....||:..:.:.       
Zfish   570 VVEFSVP----FVETGISVMVSRSNGTVSPSAFLEPYSPAVWVMMFVMCLSVVAVTVFIFEFFSP 630

  Fly   354 --HXR-------GAGDRLAL-----VLAVYAASLGLPIDPPERPSLQLLFASWLIFGLIVRSMYS 404
              : |       ..|.:..:     :|.....:..:|::.|...:.:::...|..|.:|..:.|:
Zfish   631 VGYNRSLQSGKTAGGSKFTIGKSIWLLWALVFNNSVPVENPRGTTSKIMVLVWAFFAVIFLASYT 695

  Fly   405 ALL 407
            |.|
Zfish   696 ANL 698

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir7gNP_001368933.1 None
grin2daXP_009292354.1 PBP1_iGluR_NMDA_NR2 42..441 CDD:107373
PBP2_iGluR_NMDA_Nr2 452..851 CDD:270436 46/263 (17%)
HisJ <507..>590 CDD:223904 20/116 (17%)
Lig_chan 605..877 CDD:278489 14/94 (15%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170591661
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.