DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir7g and Ir94h

DIOPT Version :9

Sequence 1:NP_001368933.1 Gene:Ir7g / 31694 FlyBaseID:FBgn0029968 Length:607 Species:Drosophila melanogaster
Sequence 2:NP_651148.2 Gene:Ir94h / 42769 FlyBaseID:FBgn0039080 Length:559 Species:Drosophila melanogaster


Alignment Length:555 Identity:120/555 - (21%)
Similarity:186/555 - (33%) Gaps:212/555 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   140 DMQGVF------AYCWRHQLINCNVMTQSSGGQVLLHTYFPYAPGQCNDSQPTR-INMFLGESWK 197
            |.:|.|      ..|.:|.::|           |:|  ||         |:.|| :|:|   |:.
  Fly   112 DKEGSFLASQILLLCQQHSMLN-----------VVL--YF---------SRWTRTLNVF---SYL 151

  Fly   198 HRDYFPSKLHNLNGCPLIVLARKVSPFLDLDEGQRELRGLEGRLLQELSRRMNFS-------IQF 255
            ...||......|:|        .:.|.:.::: .::|:|.:.|:..:||...:||       .|.
  Fly   152 AFPYFKLLKQRLSG--------SLRPKIFINQ-LKDLQGYKIRVQPDLSPPNSFSYRDRHGECQV 207

  Fly   256 SG--------LQDQLKNRT-----TWTEKQLLQKLVQERIAHLAIGYVRKRIQYATNLTPVFPHY 307
            .|        ....||..|     ||.:.::           .|..|:   ||:..|.:      
  Fly   208 GGFLWRIVENFSKSLKGDTQVLYPTWAKAKV-----------SAAEYM---IQFTRNGS------ 252

  Fly   308 SNRVVGCLLLNAHNLTSLEIWSFPFQALTWICL--VFSFLSISCLALLHXRGAGDRLALVLAVYA 370
            |:..|...::...:......:|:|...::|..:  |...||:..| ..| ...|..|.|:||...
  Fly   253 SDIGVTTTMITFKHEERYRDYSYPMYDISWCTMLPVEKPLSVEIL-FSHVLSPGSALLLILAFIL 316

  Fly   371 ASLGLPIDPPERPSLQLLFASWL------IFGLIVRSMYSA-LLFFILRYHLHQRLPGNLQDLTH 428
            ..|   |.|.....|.:.|...|      ||.|::....|| ||..::...||.|          
  Fly   317 FFL---IVPQLIKCLGITFRGRLIGMASRIFALVMLCSSSAQLLSLLMSPPLHTR---------- 368

  Fly   429 GDYAAVMGRTTLQDLREVPSLQDLL--GLKSVIVTSEREEEVLRTLDRCTLREGAGSHPLFF--- 488
                             :.|..|||  |||...:.||                      |:|   
  Fly   369 -----------------IKSFDDLLTSGLKIFGIRSE----------------------LYFLDG 394

  Fly   489 GLISQDA-LLHLTQRGHR----------AGAYHI--IPQDVLEQQLAIYLQKH------------ 528
            |..::.| ..|||:..:.          :.||.|  :..:|:|.|     |:|            
  Fly   395 GFRAKYASAFHLTENPNELYDNRNYFNTSWAYTITSVKWNVIEAQ-----QRHFAHPVFRYSTDL 454

  Fly   529 ---------------SHLASHLDHLVMSIRSVGLVHHW----------AGQMASERYFRSRFLYR 568
                           |.....|.|..:.|...||:..|          ||:|..:.|.|:..:  
  Fly   455 CFSSETPWGLLIAPESFYREPLQHFTLKINQAGLITQWMTQSFHEMVRAGRMTIKDYSRTNLM-- 517

  Fly   569 EKRIRQPDL---WAVYILTAGLYLLSLVVFICELL 600
             |.:|..||   |.::.:..|   .|.|||..|||
  Fly   518 -KPLRIQDLRKCWVIFAVGLG---TSTVVFTIELL 548



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42643
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.