DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir7g and Ir60e

DIOPT Version :9

Sequence 1:NP_001368933.1 Gene:Ir7g / 31694 FlyBaseID:FBgn0029968 Length:607 Species:Drosophila melanogaster
Sequence 2:NP_611927.3 Gene:Ir60e / 37917 FlyBaseID:FBgn0035019 Length:572 Species:Drosophila melanogaster


Alignment Length:608 Identity:131/608 - (21%)
Similarity:226/608 - (37%) Gaps:181/608 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 VLVELGRPR-------------RIAGPRTHNLLLVDS-------------LDALLDIEIHTYTAQ 119
            :|.:|..||             ||.|..|.:.|::.|             |..||| |:|     
  Fly    56 ILHKLDSPRILLSSNSREARDLRIRGNFTESTLIIVSVMDSDLNPLVASLLPRLLD-ELH----- 114

  Fly   120 SDTSEYYFIFLQQRDALIPHDMQGVFAYCWRHQLINCNVMTQSSGGQVLLHTYFPYAPGQCNDSQ 184
                |.:.:||...:...|  .|.::.||::...:  ||:..|..|   |::|.||.     ..|
  Fly   115 ----ELHIVFLSNEEPGFP--KQDLYTYCFKEGFV--NVILMSGKG---LYSYLPYP-----SIQ 163

  Fly   185 PTRINMFLGESWKHRDYFPSK--LHNLNGCPLIVLARKVSPFLDLDEGQRELRGL--EGRL---L 242
            |..::       ...:||...  :.|..|.|:.:|...::| .|. |...|..||  .|.|   :
  Fly   164 PISLS-------NVSEYFDRARIIRNFQGFPVRILRSTLAP-RDF-EYSNEQGGLVRAGYLFTAV 219

  Fly   243 QELSRRMNFSIQFSGLQDQLKNRTTWTEKQLLQKLVQERIAHLAIG---YVRK------------ 292
            :||:.|.|.:|:...:.|                 :.|...:||:.   :.:|            
  Fly   220 KELTYRYNATIESVPIPD-----------------LPEYDVYLAVAEMLHTKKIDIVCYFKDFSL 267

  Fly   293 RIQYATNLTPVFPHYSNRVVGCLLLNAHNLTSLEIWSFPFQALTWICLVFSFLSISCLALLHXRG 357
            .:.|...|:.:..::       :..:|..::|...:|.||....|..::.:.|..:.:..|..||
  Fly   268 EVAYTAPLSIIREYF-------MAPHARPISSYLYYSKPFGWTLWAVVISTVLYGTVMLHLAARG 325

  Fly   358 AGDRLALVLAVYAASLGLPIDPPERPSLQLLF--------ASW---------LIFGLIVRSMYSA 405
            |...:...| :|:.|             .:|:        |.|         .|.|.|:.::|.|
  Fly   326 ARVEIGKCL-LYSLS-------------HILYNCHQKIRVAGWRDVAIHGILTIGGFILTNVYLA 376

  Fly   406 LLFFILRYHLHQRLPGNLQDLTHGDYAAVMGRTTLQDLREVPSLQD---LLGLKSVIVTSEREEE 467
            .|..||...|:......|:||....|               |||.|   ...:|:.....||...
  Fly   377 TLSSILTSGLYDEEYNTLEDLARAPY---------------PSLHDEYYRSQMKAKTFLPERLRR 426

  Fly   468 VLRTLDRCTL---REGAGSHPLFFGLISQDAL-LHLTQRGHRAGAYHI-IPQ-DVLEQQLAIYLQ 526
            ...:|:...|   |:|.....::  ::.:|.| |.|.|:      |.: .|: :::.|.:...|:
  Fly   427 NSLSLNATLLKAYRDGLNQSYIY--ILYEDRLELILMQQ------YLLKTPRFNMIRQAVGFTLE 483

  Fly   527 KHSHLASHLDHLVMSIRSV-GLVHHWAGQMASERYFRS---RFLYREKRIRQP-----DL----W 578
            .:. :::.|.:|.|:...: .|..|..........||.   :.:|...|..:|     ||    :
  Fly   484 SYC-VSNSLPYLAMTSEFMRRLQEHGISIKMKADTFRELIHQGIYTLMRDDEPPAKAFDLDYYFF 547

  Fly   579 AVYILTAGLYLLSLVVFICELLA 601
            |..:.|.|| :.||:||..||::
  Fly   548 AFVLWTVGL-ISSLLVFFAELVS 569



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42643
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.