DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir7g and Ir56b

DIOPT Version :9

Sequence 1:NP_001368933.1 Gene:Ir7g / 31694 FlyBaseID:FBgn0029968 Length:607 Species:Drosophila melanogaster
Sequence 2:NP_611430.1 Gene:Ir56b / 37250 FlyBaseID:FBgn0034456 Length:408 Species:Drosophila melanogaster


Alignment Length:328 Identity:69/328 - (21%)
Similarity:120/328 - (36%) Gaps:111/328 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   327 IWSFPFQALTWICLVFSFLSISCLALL----HXRGAGDRL---------ALVLAVYAASLGLPID 378
            :|  |.....|.||   ||....:|||    | |..|:..         |:.|.:::|::.:.:.
  Fly   127 VW--PLGKYIWTCL---FLGTFYVALLLRYVHWREPGNATRSYTRNVLHAMALLMFSANMNMSVK 186

  Fly   379 PPERPSLQLLFASWL-IFGLIVRSMYSALLFFILRYHLHQRLPGNLQ-----------DLTHGDY 431
            ........::|.:.| |||           |.:..|||......:::           ||.|...
  Fly   187 LKHASIRVIIFYTLLYIFG-----------FILTNYHLSHMTAFDMKPVFLRPIDTWSDLIHSRL 240

  Fly   432 AAVMGRTTLQDLREVPSLQDLLGLKS----VIVTSE------REEEVLRTLDRCTLREGAGSHPL 486
            ..|:..:.|::||.:|..|.||...|    .:||.:      |:::||             ..|.
  Fly   241 RIVIHDSLLEELRWLPVYQALLASPSRSYAYVVTQDAWLFFNRQQKVL-------------IQPY 292

  Fly   487 FFGLISQDALLHLTQRGHRAGAYHIIPQDVLEQQLAIYLQKHSHLASHLDHLVMSIRSVGLVHHW 551
            |          ||::... .|.::.:|           :..::..|..|:..::::...||.::|
  Fly   293 F----------HLSKVCF-GGLFNALP-----------MASNASFADSLNKFILNVWQAGLWNYW 335

  Fly   552 ---AGQMASERYFRSRFLYREKRIRQPDLWAV------------YILTAGLYLLSLVVFICELLA 601
               |.:.|.:..:...||         |.:.|            .:|:||:.:.|| .|..||..
  Fly   336 EELAFRYAEQAGYAKVFL---------DTYPVEPLNLEFFTTAWIVLSAGIPISSL-AFCLELFI 390

  Fly   602 SRR 604
            .||
  Fly   391 HRR 393



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42643
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.