Sequence 1: | NP_001368933.1 | Gene: | Ir7g / 31694 | FlyBaseID: | FBgn0029968 | Length: | 607 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_938174.1 | Gene: | gria3b / 368416 | ZFINID: | ZDB-GENE-030616-53 | Length: | 883 | Species: | Danio rerio |
Alignment Length: | 223 | Identity: | 45/223 - (20%) |
---|---|---|---|
Similarity: | 82/223 - (36%) | Gaps: | 61/223 - (27%) |
- Green bases have known domain annotations that are detailed below.
Fly 229 EGQRELRGLEGRLLQELSRRMNFSIQFSGLQD---QLKNRTTWTEKQLLQKLVQER----IAHLA 286
Fly 287 IGYVRKR-IQYATNLTPVFPHYSNRVVGCLLLNAHNLTSLEIWSF--PFQALTWICLVFSFLSIS 348
Fly 349 CLALLHXRGAGDRLALVLAVYAASLGL------PIDPPERPSLQLLFAS---------------- 391
Fly 392 ------------WLIFGLIVRSMYSALL 407 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Ir7g | NP_001368933.1 | None | |||
gria3b | NP_938174.1 | Periplasmic_Binding_Protein_Type_1 | 25..396 | CDD:299141 | |
ANF_receptor | 36..379 | CDD:279440 | |||
PBP2_iGluR_AMPA | 412..794 | CDD:270433 | 45/223 (20%) | ||
Lig_chan | 544..824 | CDD:278489 | 23/107 (21%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C170591773 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.840 |