DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir7g and gria3b

DIOPT Version :9

Sequence 1:NP_001368933.1 Gene:Ir7g / 31694 FlyBaseID:FBgn0029968 Length:607 Species:Drosophila melanogaster
Sequence 2:NP_938174.1 Gene:gria3b / 368416 ZFINID:ZDB-GENE-030616-53 Length:883 Species:Danio rerio


Alignment Length:223 Identity:45/223 - (20%)
Similarity:82/223 - (36%) Gaps:61/223 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   229 EGQRELRGLEGRLLQELSRRMNFSIQFSGLQD---QLKNRTTWTEKQLLQKLVQER----IAHLA 286
            ||..:..|....|..|:::.:....:.|.:.|   ..::..|.:...::.:||..|    :|.|.
Zfish   436 EGNEKYEGYCVDLASEIAKHVGIKYRLSIVMDGKYGARDPETKSWNGMVGELVYGRADIAVAPLT 500

  Fly   287 IGYVRKR-IQYATNLTPVFPHYSNRVVGCLLLNAHNLTSLEIWSF--PFQALTWICLVFSFLSIS 348
            |..||:. |.::.      |..|..:  .:::.....:...::||  |.....|:|:||:::.:|
Zfish   501 ITLVREEVIDFSK------PFMSLGI--SIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVS 557

  Fly   349 CLALLHXRGAGDRLALVLAVYAASLGL------PIDPPERPSLQLLFAS---------------- 391
            .:..|..|         .:.|...|..      |..||:.|:...:|.|                
Zfish   558 VVLFLVSR---------FSPYEWQLDETDEVKDPQTPPDPPNDFGIFNSLWFSLGAFMQQGCDIS 613

  Fly   392 ------------WLIFGLIVRSMYSALL 407
                        |..|.||:.|.|:|.|
Zfish   614 PRSLSGRIVGGVWWFFTLIIISSYTANL 641

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir7gNP_001368933.1 None
gria3bNP_938174.1 Periplasmic_Binding_Protein_Type_1 25..396 CDD:299141
ANF_receptor 36..379 CDD:279440
PBP2_iGluR_AMPA 412..794 CDD:270433 45/223 (20%)
Lig_chan 544..824 CDD:278489 23/107 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170591773
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.