DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir7g and Ir52a

DIOPT Version :9

Sequence 1:NP_001368933.1 Gene:Ir7g / 31694 FlyBaseID:FBgn0029968 Length:607 Species:Drosophila melanogaster
Sequence 2:NP_611041.2 Gene:Ir52a / 36715 FlyBaseID:FBgn0034023 Length:599 Species:Drosophila melanogaster


Alignment Length:550 Identity:106/550 - (19%)
Similarity:193/550 - (35%) Gaps:126/550 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 YTAQSDTSEYYFIFLQQRDALI-PHDMQGVFAYCWRHQLINCN--VMTQSSGGQVLLHTYFPYAP 177
            |.|:::.:.|..:.||:...|| ..|.....:.|.|:.|...:  .|.:|...|  ..|::    
  Fly    97 YDAENEENSYTLMKLQRTRRLIYLEDNSEPESVCMRYSLKEQHNIAMVKSDFDQ--SDTFY---- 155

  Fly   178 GQCNDSQPTRINMFLGESWKHRDYFPSKLHNLNGCPLIVLARKVSP----FLDLDEGQRELRGLE 238
             .|...|..  |...|..:|.:..:.....|:.|..:..:|..:.|    :.|...|:.::.|..
  Fly   156 -SCRLFQTP--NYVEGHFFKDQPIYIENFQNMRGATIRTVADSLVPRTILYRDEKSGETKMMGYL 217

  Fly   239 GRLLQELSRRMNFSIQF------SGLQDQLKNRTTWTEKQLLQKLVQERIAHLAIGYVRKRIQYA 297
            |.::...::::|..:.|      ...:..:.:...|..:.::.           ||.........
  Fly   218 GHMINTYAQKLNAKLHFIDTSKLGAKKPSVLDIMNWVNEDIVD-----------IGTALASSLQF 271

  Fly   298 TNLTPVFPHYSNRVVG-CLLLNA-----HNLTSLEIWSFPFQALTWICLVFSFLSISCLALL--- 353
            .|:..|:  |...:.| ||::..     :||    ::|.....|. :.::|..|.:..:.::   
  Fly   272 KNMDSVW--YPYLLTGYCLMVPVPAKMPYNL----VYSMIVDPLV-LSIIFVMLCLFSVLIIYTQ 329

  Fly   354 HXRGAGDRLALVLAVYAASLGL-----PIDPPERPSLQLLFASWLIFGLIVRSMYSALLFFILRY 413
            | ......||.:|....:..||     |..|.....|:|:........:::.:||.|.|      
  Fly   330 HLSWKNLTLANILLNDKSLRGLLGQSFPFPPNPSKHLKLIIFVLCFASVMITTMYEAYL------ 388

  Fly   414 HLHQRLPGNLQDLTHGDYAAVMGRTTLQDLREVPSLQDLLGLKSVIVTSEREEEVLRTLDRCTLR 478
                          ...:........::..|::.:    ..||..|  |..|..||.:|:....|
  Fly   389 --------------QSYFTQPPSEPYIRSFRDIGN----SSLKMAI--SRLEVNVLTSLNNSHFR 433

  Fly   479 EGAGSHPLFFGLISQDALLHLTQRGHRAGAYHIIPQDV-----LEQQLAIYLQKHSHLASHL--- 535
            |.:..|.|.|..:|:    :|..|.....:: |.|..|     .|:|..::.:...:||::|   
  Fly   434 EISEDHLLIFDDLSE----YLVLRDSFNTSF-IFPVSVDRWNGYEEQQKLFAEPAFYLATNLCFN 493

  Fly   536 --------------------DHLVMSIRSVGLVHHWAGQ---------MAS-ERYFRSRFLYREK 570
                                ||: |.....|||..|..|         :|| |...|.|  ..|.
  Fly   494 QFMLFSPPLRRYLPHRHLFEDHM-MRQHEFGLVTFWKSQSFIEMVRLGLASMEDLSRKR--NEEV 555

  Fly   571 RIRQPDLWAVYILTAGLYLLSLVVFICELL 600
            .:...|:..:..|..|...:|...||.|:|
  Fly   556 SLLLDDISWILKLYLGAMFISSFCFILEIL 585



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42643
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.