DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir7g and Ir10a

DIOPT Version :9

Sequence 1:NP_001368933.1 Gene:Ir7g / 31694 FlyBaseID:FBgn0029968 Length:607 Species:Drosophila melanogaster
Sequence 2:NP_001096949.1 Gene:Ir10a / 32067 FlyBaseID:FBgn0083979 Length:609 Species:Drosophila melanogaster


Alignment Length:581 Identity:113/581 - (19%)
Similarity:208/581 - (35%) Gaps:148/581 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 NLLLVDSLDALLDIEIHTYTAQSDTSEYYFIFLQQRDALIPHD--MQGVFAYCW-RHQLINCNVM 159
            ||:||.|||.||.........|..::.:|.:..|.:|......  ::|.....| :|::.|...:
  Fly    86 NLVLVMSLDQLLTNRGAAAPIQKASTFFYILADQDKDLSADEQLRLEGSCRQLWTQHKVYNRFFL 150

  Fly   160 TQSSGGQVLLHTYFPYAPGQCNDSQPTRINMFLGESWKHRDYFPSKLHNLNGCPL-IVLARKV-- 221
            |:..        .:.|.|.:..||...|:..:.|.....:..|    .::.|.|| |.:.|.|  
  Fly   151 TRDG--------VWIYDPFKRRDSAFGRLVRYYGSETLDKLLF----RDMAGYPLRIQMFRSVYT 203

  Fly   222 SPFLDLDEG-QRELRGLEGRLLQELSRRMNFSI-----------------QFSG-----LQDQLK 263
            .|..|.:.| ...:.|::..:.|.|..|:||::                 .::|     ::|.|.
  Fly   204 RPEFDKETGLLTRVTGVDFLVAQMLRERLNFTMLLQQPEKKYFGERSANGSYNGAIGSIIKDGLD 268

  Fly   264 NRTT--WTEKQLLQKLVQERIA----HLAIGYVRKRIQYATNLTPVFPHYSNRVVGCLLLNAHNL 322
            ...|  :.:..|:|:.:...:|    .|.| ||.|..:...::.|:|      .||         
  Fly   269 ICLTGFFVKDYLVQQYMDFTVAVYDDELCI-YVPKASRIPQSILPIF------AVG--------- 317

  Fly   323 TSLEIW-SFPFQ----ALTWICLVFSFLSISCLALLHXRGAGDRLALVLAVYAASL-----GLPI 377
              .:|| .|...    ||.|:.|....|.:..::|.: ...|..|.:::..:...:     .||.
  Fly   318 --YDIWLGFVLTAFACALIWLTLRVINLKLRIVSLGNQHIVGQALGIMVDTWVVWVRLNLSHLPA 380

  Fly   378 DPPERPSLQLLFASWLIFGLIVRSMYSALLFFILRYHLHQRLPGNLQDLTHGDYAAVMGRTTLQD 442
            ...||..:..|....:|||.|..|..:.:....|.|          :|:           .|:|:
  Fly   381 SYAERMFIGTLCLVSVIFGAIFESSLATVYIHPLYY----------KDI-----------NTMQE 424

  Fly   443 LREVPSLQDLLGLKSVIVTSEREEEVLRTLDRCTLREGAGSHPLFFGL---------ISQDALLH 498
            |       |..|||.|...|...:::.          .:.:.|||..|         :..|.:..
  Fly   425 L-------DESGLKVVYKYSSMADDLF----------FSETSPLFASLNKKLSWNRDLRADVIDE 472

  Fly   499 LTQRGHRAGAYH------------------IIPQDVLEQQLAIYLQKHSHLASHLDHLVMSIRSV 545
            :.:..::||...                  ::|:......::..:.:.|.....::.|::...:.
  Fly   473 VARFRNKAGVSRYTSLILESSHFTLLRKIWVVPECPKYYTISYVMPRDSPWEDAVNALLLRFLNA 537

  Fly   546 GLVHHWAGQMAS--ERYFRSRFLYRE------KRIRQPDLWAVYILTAGLYLLSLVVFICE 598
            ||:..|.....|  :...||..|..:      :.:...||...:.:..|..||:.:.|:.|
  Fly   538 GLIVKWIQDEKSWVDIKMRSNILEADAESELVRVLTIGDLQLAFYVVIGGNLLAFLGFLAE 598

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir7gNP_001368933.1 None
Ir10aNP_001096949.1 Periplasmic_Binding_Protein_Type_2 220..>294 CDD:304360 12/73 (16%)
TM_PBP1_branched-chain-AA_like 315..>411 CDD:294309 23/106 (22%)
Lig_chan 319..587 CDD:278489 52/305 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42643
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.