DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir7g and Ir94c

DIOPT Version :9

Sequence 1:NP_001368933.1 Gene:Ir7g / 31694 FlyBaseID:FBgn0029968 Length:607 Species:Drosophila melanogaster
Sequence 2:NP_732701.2 Gene:Ir94c / 318727 FlyBaseID:FBgn0051423 Length:604 Species:Drosophila melanogaster


Alignment Length:339 Identity:63/339 - (18%)
Similarity:104/339 - (30%) Gaps:101/339 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   310 RVVGCLLLNAHNLTSLEIWSFPFQALTWICLVFSFLSISCLALLHXRGAGDRLALVL-------A 367
            :::||||:                    ...||..:....|.|.| |.:|..:.|..       .
  Fly   303 KLIGCLLI--------------------AYAVFVLIETLILWLTH-RISGREVRLTSLNQLLNPR 346

  Fly   368 VYAASLGLPIDPPERPSLQL--LFASWLIFGLIVRSMYSALLFFILRYHLHQRLPGNLQDLTHGD 430
            .:...||||.....|.|:.|  ||....:|||:..:..|..|..:|..........|.::|....
  Fly   347 AFRGILGLPFPEFRRSSISLRQLFLVISVFGLVYSNFVSCTLSALLTKPAQNPQVRNFKELRDSG 411

  Fly   431 YAAVMGRTT----------------------LQD---LREVPSLQDLLGLKSVIVTSEREEEVLR 470
            ...:|.:.|                      ||.   ||.:.:..|.........|.:....|.:
  Fly   412 LITIMDKYTHSFIEKHIDPEFFDHVLPHYLILQKKEALRMIWNFNDSYSYVMYTTTWKSLNTVQK 476

  Fly   471 TLDRCTLREGAGSHPLFFGLISQDALLHLTQRGHRAGAYHIIPQDVLEQQLAIYLQKHSHLASHL 535
            :.|.....|...                ||...:....|.:....||:..|:.|           
  Fly   477 SFDERVFCESES----------------LTIAWNLPRMYVLGNNSVLKWMLSRY----------- 514

  Fly   536 DHLVMSIRSVGLVHHWAGQMASERYFRSRFLYR---EKRIRQPDL--------WAVYILTAGLYL 589
               :..:...|:...|..|:...    .:.||.   .:||::..:        |..::|..|..:
  Fly   515 ---ITYMPQTGIPDSWTEQLPKV----LKLLYNVTSPRRIKEGAVPLSIQHLSWIWHLLFIGESI 572

  Fly   590 LSLVVFICELLASR 603
            .:| |||.|:|..:
  Fly   573 ATL-VFIVEILLQK 585



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42643
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.