DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir7g and GRIN2D

DIOPT Version :9

Sequence 1:NP_001368933.1 Gene:Ir7g / 31694 FlyBaseID:FBgn0029968 Length:607 Species:Drosophila melanogaster
Sequence 2:NP_000827.2 Gene:GRIN2D / 2906 HGNCID:4588 Length:1336 Species:Homo sapiens


Alignment Length:392 Identity:75/392 - (19%)
Similarity:126/392 - (32%) Gaps:131/392 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 ALIPHDMQGVFAYCWRHQL---INCNVMTQSSGGQVLLHTY--FPYAPGQCNDSQPTR-----IN 189
            |.:|..:..|.:..||..|   :...|...:.|.|.||..|  .|.....|.....|.     ..
Human   298 APLPAGLFAVRSAGWRDDLARRVAAGVAVVARGAQALLRDYGFLPELGHDCRAQNRTHRGESLHR 362

  Fly   190 MFLGESWKHRDYFPSKLHNLNGCPLIVLARKVSPFLDLDE-----GQRELRGLE---------GR 240
            .|:..:|.:|||..::...|....|:|::      |..|.     |..|.:.|.         ||
Human   363 YFMNITWDNRDYSFNEDGFLVNPSLVVIS------LTRDRTWEVVGSWEQQTLRLKYPLWSRYGR 421

  Fly   241 LLQELSRRMNFSI---------------QFSG--LQDQLK-----NRT-------TWTEKQLLQK 276
            .||.:....:.::               ..||  ::|.:.     |||       ...||:..:.
Human   422 FLQPVDDTQHLTVATLEERPFVIVEPADPISGTCIRDSVPCRSQLNRTHSPPPDAPRPEKRCCKG 486

  Fly   277 L---VQERIAHLAIGYV-----------RKRIQYATN--LTPVFPHYSNRVVGCLLLN------- 318
            .   :.:|:|| .||:.           .|:|....|  :..||...::..:|.|.:|       
Human   487 FCIDILKRLAH-TIGFSYDLYLVTNGKHGKKIDGVWNGMIGEVFYQRADMAIGSLTINEERSEIV 550

  Fly   319 -----------------AHNLTSLEIWSFPFQALTWI-----CL------VFSFLSISCLALLHX 355
                             ::...|...:..|:....|:     ||      ||.|..:|.:.... 
Human   551 DFSVPFVETGISVMVARSNGTVSPSAFLEPYSPAVWVMMFVMCLTVVAVTVFIFEYLSPVGYNRS 615

  Fly   356 RGAGDR---------------LALVLAVYAASLGLPIDPPERPSLQLLFASWLIFGLIVRSMYSA 405
            ...|.|               .|||.     :..:|::.|...:.:::...|..|.:|..:.|:|
Human   616 LATGKRPGGSTFTIGKSIWLLWALVF-----NNSVPVENPRGTTSKIMVLVWAFFAVIFLASYTA 675

  Fly   406 LL 407
            .|
Human   676 NL 677

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir7gNP_001368933.1 None
GRIN2DNP_000827.2 PBP1_iGluR_NMDA_NR2 49..413 CDD:380601 28/120 (23%)
PBP2_iGluR_NMDA_Nr2 430..830 CDD:270436 43/254 (17%)
Glutamate binding. /evidence=ECO:0000250|UniProtKB:Q00959 539..541 0/1 (0%)
Pore-forming. /evidence=ECO:0000250|UniProtKB:Q00960 631..650 4/23 (17%)
Glutamate binding. /evidence=ECO:0000250|UniProtKB:Q00959 717..718
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 900..934
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 981..1123
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1225..1336
PDZ-binding. /evidence=ECO:0000250 1334..1336
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165156170
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.