DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir7g and Grin3a

DIOPT Version :9

Sequence 1:NP_001368933.1 Gene:Ir7g / 31694 FlyBaseID:FBgn0029968 Length:607 Species:Drosophila melanogaster
Sequence 2:NP_612555.1 Gene:Grin3a / 191573 RGDID:621704 Length:1135 Species:Rattus norvegicus


Alignment Length:630 Identity:123/630 - (19%)
Similarity:184/630 - (29%) Gaps:251/630 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 LGRPRRIAGPRTHNLLLVDSLDALLDIEIHTYTAQSDTSEYYF--------------IFLQQRDA 135
            ||..:.:...||..|        .|.:..|..|.|| ..|||.              ..:|...|
  Rat   356 LGDSQNVEELRTEGL--------PLGLIAHGKTTQS-VFEYYVQDAMELVARAVATATMIQPELA 411

  Fly   136 LIPHDMQGVFAYCWRHQLINC-NVMTQS-SGGQ----VLLHTYFPYAPGQCNDSQPTRI----NM 190
            |:|..|             || :|.|.: :.||    .|.:|.|....|.......|.|    |.
  Rat   412 LLPSTM-------------NCMDVKTTNLTSGQYLSRFLANTTFRGLSGSIKVKGSTIISSENNF 463

  Fly   191 FLGE---------------SW-----------------KHRDYF--PSKLHNLNGCPLI----VL 217
            |:..               ||                 :|:.:|  |:||| |....||    |.
  Rat   464 FIWNLQHDPMGKPMWTRLGSWQGGRIVMDSGIWPEQAQRHKTHFQHPNKLH-LRVVTLIEHPFVF 527

  Fly   218 ARKVSPFLDLDEG-------------------QRELRGLEGR------------------LLQEL 245
            .|:|.     |||                   .|....|...                  ||::|
  Rat   528 TREVD-----DEGLCPAGQLCLDPMTNDSSMLDRLFSSLHSSNDTVPIKFKKCCYGYCIDLLEQL 587

  Fly   246 SRRMNFSIQF----SGLQDQLKNRTTWT--EKQLLQKLVQERIAHLAIGYVRKRIQYATNLTPVF 304
            :..|||....    .|.....|| ..||  ...||.......:...:|...|.::...|:     
  Rat   588 AEDMNFDFDLYIVGDGKYGAWKN-GHWTGLVGDLLSGTANMAVTSFSINTARSQVIDFTS----- 646

  Fly   305 PHYSNRVVGCLLLNAHNLTSLEIWSFPFQALTWICL----------------------------- 340
            |.:|.. :|.|:........:..:.:|.....|:.:                             
  Rat   647 PFFSTS-LGILVRTRDTAAPIGAFMWPLHWTMWLGIFVALHITAIFLTLYEWKSPFGMTPKGRNR 710

  Fly   341 --VFSFLSI--SCLALLHXRGAGDRLALVLAVYAASLGLPIDPPERPSLQLLFASWLIFGLIVRS 401
              ||||.|.  .|.|||..|.|.                 |.||:..:.:.|...|.||.:...|
  Rat   711 NKVFSFSSALNVCYALLFGRTAA-----------------IKPPKCWTGRFLMNLWAIFCMFCLS 758

  Fly   402 MYSALLFFILRYHLHQRLPGNLQDLTHGDYAAVM-GRTTLQDLREV--PSL-QDLLGLKSVIVTS 462
            .|:|.|                        |||| |....::|..:  |.| ....|.:...|..
  Rat   759 TYTANL------------------------AAVMVGEKIYEELSGIHDPKLHHPSQGFRFGTVRE 799

  Fly   463 EREEEVLR----TLDRCTLREGAGSHPLFFGLISQDALLHLTQRGHRAGAYHIIPQDVLEQQLAI 523
            ...|:.:|    .:.....|....:.|        |.:.:|.....:..|: |:.:.:|:.:::|
  Rat   800 SSAEDYVRQSFPEMHEYMRRYNVPATP--------DGVQYLKNDPEKLDAF-IMDKALLDYEVSI 855

  Fly   524 -----------------Y---LQKHSHLASHLDHLVMSIRSVGLV 548
                             |   |..:|.|.|::..|:...:|.|.:
  Rat   856 DADCKLLTVGKPFAIEGYGIGLPPNSPLTSNISELISQYKSHGFM 900

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir7gNP_001368933.1 None
Grin3aNP_612555.1 PBP1_iGluR_NMDA_NR3 30..497 CDD:107372 34/162 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 60..117
ANF_receptor 127..469 CDD:279440 32/134 (24%)
PBP2_iGluR_NMDA_Nr3 512..908 CDD:270438 86/452 (19%)
Lig_chan 676..942 CDD:278489 51/275 (19%)
PPP2CB binding site 951..987
GIT1-binding. /evidence=ECO:0000269|PubMed:24297929 1082..1115
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166350016
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.