DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir7g and Grin3b

DIOPT Version :9

Sequence 1:NP_001368933.1 Gene:Ir7g / 31694 FlyBaseID:FBgn0029968 Length:607 Species:Drosophila melanogaster
Sequence 2:NP_579842.2 Gene:Grin3b / 170796 RGDID:621705 Length:1002 Species:Rattus norvegicus


Alignment Length:330 Identity:66/330 - (20%)
Similarity:106/330 - (32%) Gaps:128/330 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   241 LLQELSRRMNFSIQ--------FSGLQDQLKNRTTWTEKQLLQKLVQERIAHLA-----IGYVRK 292
            ||:.|:..:.|..:        :..|:|     ..||  .|:..|:..| ||:|     |...|.
  Rat   483 LLERLAEDLAFDFELYIVGDGKYGALRD-----GRWT--GLVGDLLAGR-AHMAVTSFSINSARS 539

  Fly   293 RIQYATNLTPVFPHYSNRVVGCLLLNAHNLTSLEIWSFPFQALTWICLVFSFLSISCLALL---- 353
            ::...|:     |.:|.. :|.::......:.:..:.:|.....|:. ||:.|.::.|.|.    
  Rat   540 QVVDFTS-----PFFSTS-LGIMVRTRDTASPIGAFMWPLHWSMWVG-VFAALHLTALFLTLYEW 597

  Fly   354 --------HXRGAGDRLALVLAV---YAASLGLPID--PPERPSLQLLFASWLIFGLIVRSMYSA 405
                    ..|..|...:...|:   ||...|..:.  .|:.|:.:.|...|.||.|:|.|.|:|
  Rat   598 RSPYGLTPRGRNRGTVFSYSSALNLCYAILFGRTVSSKTPKCPTGRFLMNLWAIFCLLVLSSYTA 662

  Fly   406 LLFFILRYHLHQRLPGNLQDLTHGDYAAVM-GRTTLQDLREVPSLQDLLGLKSVIVTSEREEEVL 469
            .|                        |||| |..|.::|                          
  Rat   663 NL------------------------AAVMVGDKTFEEL-------------------------- 677

  Fly   470 RTLDRCTLREGAGSHPLFFGLISQDALLHLTQRGHRAGAYHIIPQDVLEQQLAIYL-----QKHS 529
                       :|.|         |..||...:|.|.|.       |.|.....|:     :.|:
  Rat   678 -----------SGIH---------DPKLHHPSQGFRFGT-------VWESSAEAYIKASFPEMHA 715

  Fly   530 HLASH 534
            |:..|
  Rat   716 HMRRH 720

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir7gNP_001368933.1 None
Grin3bNP_579842.2 PBP1_iGluR_NMDA_NR3 21..405 CDD:107372
PBP2_iGluR_NMDA_Nr3 414..808 CDD:270438 66/330 (20%)
Lig_chan 576..842 CDD:278489 45/223 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 882..910
Involved in the trafficking and surface expression of NMDARs. /evidence=ECO:0000250 951..984
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166350129
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.