DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir7g and gria2a

DIOPT Version :9

Sequence 1:NP_001368933.1 Gene:Ir7g / 31694 FlyBaseID:FBgn0029968 Length:607 Species:Drosophila melanogaster
Sequence 2:XP_005170953.1 Gene:gria2a / 170450 ZFINID:ZDB-GENE-020125-3 Length:893 Species:Danio rerio


Alignment Length:374 Identity:71/374 - (18%)
Similarity:121/374 - (32%) Gaps:111/374 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   157 NVMTQSSGGQVLLHTYFPYAPGQCNDSQPTRINMFLGESWKHRDYFPSKLHNLNGCPLIVLARKV 221
            |||...:.|.|.:        |..|:.....:.        ..|.||:....:....:||.....
Zfish   368 NVMELKNSGPVKI--------GYWNEMDKMAVT--------KSDLFPNDTMGMENKTVIVTTILE 416

  Fly   222 SPFL------DLDEGQRELRGLEGRLLQELSRRMNFSIQFSGLQDQLKNRTTWTEKQLLQKLVQE 280
            :|::      :|........|....|..|:::...|..|...:.|. |......|.::...:|.|
Zfish   417 APYVMLKKNAELFTDNERYEGYCVDLAAEIAKHCGFKYQLRIVADG-KYGARDAETKIWNGMVGE 480

  Fly   281 --------RIAHLAIGYVRKR-IQYATNLTPVFPHYSNRVVGCLLLNAHNLTSLEIWSF--PFQA 334
                    .:|.|.|..||:. |.::.      |..|..:  .:::.....:...::||  |...
Zfish   481 LVYGKADIAVAPLTITLVREEVIDFSK------PFMSLGI--SIMIKKPQKSKPGVFSFLDPLAY 537

  Fly   335 LTWICLVFSFLSISCLALLHXR-------------------------GAGDRLALVLAVYAASLG 374
            ..|:|:||:::.:|.:..|. |                         |..:.|...|..:... |
Zfish   538 EIWMCIVFAYIGVSVVLFLVSRFSPYEWHTEEFEDGQLGPSESTNEFGIFNSLWFSLGAFMQQ-G 601

  Fly   375 LPIDPPERPSLQLLFASWLIFGLIVRSMYSALLFFILRYHLHQRLPGNLQDLTHGDYAAVMGRTT 439
            ..|. |...|.:::...|..|.||:.|.|:|.|...|                          |.
Zfish   602 CDIS-PRSLSGRIVGGVWWFFTLIIISSYTANLAAFL--------------------------TV 639

  Fly   440 LQDLREVPSLQDLLGLKSVIVTSEREEEVLRTLDRCTLREGAGSHPLFF 488
            .:.:..:.|.:||         :::.|....|||       |||...||
Zfish   640 ERMVSPIESAEDL---------AKQTEIAYGTLD-------AGSTKEFF 672

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir7gNP_001368933.1 None
gria2aXP_005170953.1 Periplasmic_Binding_Protein_Type_1 23..391 CDD:299141 7/30 (23%)
ANF_receptor 51..373 CDD:279440 3/4 (75%)
PBP2_iGluR_AMPA 406..783 CDD:270433 61/320 (19%)
Lig_chan 538..816 CDD:278489 36/179 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170591738
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.