DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir7g and grid2

DIOPT Version :9

Sequence 1:NP_001368933.1 Gene:Ir7g / 31694 FlyBaseID:FBgn0029968 Length:607 Species:Drosophila melanogaster
Sequence 2:XP_031759030.1 Gene:grid2 / 100487676 XenbaseID:XB-GENE-955038 Length:1007 Species:Xenopus tropicalis


Alignment Length:420 Identity:83/420 - (19%)
Similarity:136/420 - (32%) Gaps:126/420 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   207 HNLNGCPLIVLARKVSPFLDLDEG----QRELRGLEGRLLQELSRRMNFSIQFSGLQDQLKNRT- 266
            :|:.|..|.|......||:.:.|.    .::.:|....:|..||..:.|..:.....|...... 
 Frog   436 NNMRGVVLRVATVLEEPFVMVSENVLGKPKKYQGFSIDVLDALSSYLGFKYEIYVASDHKYGSPQ 500

  Fly   267 ---TWTE--KQLLQKLVQERIAHLAIGYVRKRIQYATNLTPVFPHYSNRVVGCLLLNAHNLTSLE 326
               :|..  .:||.|.....|:.|.|...|:.:   .:.|..:..||   ||.||..|.....:.
 Frog   501 ADGSWNGLIGELLLKRADMGISALTITPDRENV---VDFTTRYMDYS---VGVLLRKAEKTVDMF 559

  Fly   327 IWSFPFQALTWICLVFSFLSISCLALLHXRGAGDRLALVLAVYAASLGLPIDPP----------- 380
            ....||....|.|:                 ||..|.:.|.||..:.   ::||           
 Frog   560 ACLAPFDLSLWACI-----------------AGTVLLVGLLVYLLNW---LNPPRLQMGSMTSTT 604

  Fly   381 -----------------ERP----SLQLLFASWLIFGLIVRSMYSALLFFILRYHLHQRLPGNLQ 424
                             |.|    :.:::..:|.:|.|||.|.|:|.|...|.....:....:||
 Frog   605 LYNSMWFVYGSFVQQGGEVPYTTLATRMMMGAWWLFALIVISSYTANLAAFLTISRIESSIQSLQ 669

  Fly   425 DL---THGDYAAVMGRTTLQDLREVPSLQDLLGLKSVIVTSERE---EEVLRTLDRCTLREGAGS 483
            ||   |...|..|......:.:|       :.|:...    ||:   .::.|.::|....|....
 Frog   670 DLSRQTDIPYGTVFDSAVYEHVR-------VKGMNPF----ERDSMYSQMWRMINRSNGSENNVQ 723

  Fly   484 HPL---------------------FFGLISQDALLH-----LTQRGHRAGAYHIIP-QDVLEQQL 521
            ..|                     :..:..||...:     :..||:.....|..| :|:..|::
 Frog   724 ESLEGIQKVKHGNYAFVWDAAVLEYIAINDQDCSFYTVGNTIADRGYGIALQHGSPYRDIFSQRI 788

  Fly   522 AIYLQKHSHLASHLDHLVMSIRSVGLVHHW 551
             :.||::..         |.|    |.|.|
 Frog   789 -LELQQNGD---------MDI----LKHKW 804

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir7gNP_001368933.1 None
grid2XP_031759030.1 Periplasmic_Binding_Protein_type1 28..429 CDD:415822
PBP2_iGluR_delta_2 440..806 CDD:270449 82/416 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.