DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir7g and LOC100149482

DIOPT Version :9

Sequence 1:NP_001368933.1 Gene:Ir7g / 31694 FlyBaseID:FBgn0029968 Length:607 Species:Drosophila melanogaster
Sequence 2:XP_009290417.1 Gene:LOC100149482 / 100149482 -ID:- Length:1959 Species:Danio rerio


Alignment Length:289 Identity:63/289 - (21%)
Similarity:112/289 - (38%) Gaps:69/289 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   327 IW-----SFPFQALTWICLVFSFLSISCLALLHXRG---AGDRLALVLAVYAASLGLPI------ 377
            ||     |.|...|:.:|.:.:...:..|.... |.   |...||.:|...:|..||||      
Zfish    94 IWLQVNDSSPRTLLSQLCDLLAARPLQGLVYEDERPLPLATGPLAPMLEFVSAQTGLPIVAVGGG 158

  Fly   378 -----DPPERPSLQLLFAS------WLIFGLIVRSMYSALLFFILRYHLHQRLPGNLQDLTHGDY 431
                 .|.|..|:.|.|:|      .:||.::....::|......|:|.:|.....::.||.|.:
Zfish   159 AALGRVPQESGSIFLQFSSSTALQLEVIFEVLEEYDWTAFSVVSTRHHGYQDFLSVVEGLTDGSF 223

  Fly   432 AAVMGRT-TLQDLREVPSLQDLLGLKSVIVTSEREEEVLRTLDRCTLREG------------AGS 483
            .....:: .:.:|.:.|.     |:::..:..|.|.:|  .|..|:..|.            ||:
Zfish   224 IGWEKKSIVMLNLTDDPG-----GVRTQRLLKENEAQV--RLLYCSQEEAEQVFLAAWAAGQAGA 281

  Fly   484 HPLFFGL---ISQDALLHLTQRGHRAGAYHIIPQ---DVLEQQLA--IYLQKHSHLASHLD---- 536
            ..::|.:   :|:..|..|.:|     .:.:.||   |...:::|  :.:..|..:|...|    
Zfish   282 SHIWFAVGPALSELGLTGLPKR-----LFAVRPQGWRDEPRRRIARGVSILTHGAVALRKDYGAT 341

  Fly   537 ---HLVMSIRSVG-LVHHWAGQMASERYF 561
               |.|.:.::.| ......|:|   |||
Zfish   342 GGPHFVTNCQTDGNRTQRIRGRM---RYF 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir7gNP_001368933.1 None
LOC100149482XP_009290417.1 PBP1_iGluR_NMDA_NR2 44..421 CDD:107373 63/289 (22%)
PBP2_iGluR_NMDA_Nr2 433..831 CDD:270436
HisJ <487..>570 CDD:223904
Lig_chan 585..857 CDD:278489
NMDAR2_C 868..>900 CDD:287527
FAM76 <1763..>1856 CDD:292665
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170591662
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.