DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir7g and grin2ca

DIOPT Version :9

Sequence 1:NP_001368933.1 Gene:Ir7g / 31694 FlyBaseID:FBgn0029968 Length:607 Species:Drosophila melanogaster
Sequence 2:NP_001352716.1 Gene:grin2ca / 100003342 ZFINID:ZDB-GENE-070822-3 Length:1400 Species:Danio rerio


Alignment Length:405 Identity:68/405 - (16%)
Similarity:140/405 - (34%) Gaps:140/405 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   241 LLQELSRRMNFSIQF----SGLQDQLKNRTTWTEKQLLQKLVQERIAHLAIGYV---RKRIQYAT 298
            :|::|||.:.||...    :|...:|. |..|  ..::.::..:| |.:|||.:   .:|.:...
Zfish   471 ILKKLSRNIKFSYDLYLVTNGKHGKLV-RGIW--NGMIGEVFYKR-ADMAIGSLTINEERSEIID 531

  Fly   299 NLTPVFPHYSNRVVGCLLLNAHNLTSLEIWSFPFQALTWICLVFSFLSISCLALL---HXRGAGD 360
            ...|    :....:..::..::...|...:..|:....|:.:....|::..:.:.   : ...|.
Zfish   532 FSVP----FVETGISVMVARSNGTVSPSAFLEPYSPAVWVMMFVMCLTVVAVTVFVFEYCSPVGY 592

  Fly   361 RLALVLA--------------------VYAASLGLPIDPPERPSLQLLFASWLIFGLIVRSMYSA 405
            ..:||.|                    |:..|  :||:.|:..:.:::...|..|.:|..:.|:|
Zfish   593 NRSLVSAKDPGGPTFTIGKSVWLLWGIVFNNS--VPIENPKGTTSKIMVLVWAFFAVIFLASYTA 655

  Fly   406 LL--FFILRYHLHQRLPGNLQDLTHGDYAAVMGRTTLQDLREVPSLQDLLGLKSVIVTSEREEEV 468
            .|  |.|...::         |...|          |.| ::....||                 
Zfish   656 NLAAFMIQEQYI---------DTVSG----------LSD-KKFQKPQD----------------- 683

  Fly   469 LRTLDRCTLREGAGSHPLF-FGLISQDALLHLTQRGHRAGAYHIIPQDVLEQQLAIYLQKHSHLA 532
                          .:|.| ||.:...:    |:|..|:.                |.:.|||:.
Zfish   684 --------------QYPPFRFGTVPNGS----TERNIRSN----------------YPEMHSHMV 714

  Fly   533 SH----LDHLVMSIRS---------VGLVHHWAGQ--------MASERYFRSR----FLYREKRI 572
            .:    ::..:.|:::         ..::::.||:        :.|.:.|.:.    .|.:|.|.
Zfish   715 KYNQKGVEDALNSLKTGKLDAFIYDAAVLNYMAGKDEGCKLVTIGSGKVFATTGYGIALQKESRW 779

  Fly   573 RQP-DLWAVYILTAG 586
            ::| ||..:..|..|
Zfish   780 KRPIDLALLQFLADG 794

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir7gNP_001368933.1 None
grin2caNP_001352716.1 PBP1_iGluR_NMDA_NR2 38..398 CDD:107373
PBP2_iGluR_NMDA_Nr2 409..810 CDD:270436 68/405 (17%)
NMDAR2_C 847..>938 CDD:313729
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170591718
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.