DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir7c and GLR3.5

DIOPT Version :9

Sequence 1:NP_001245572.1 Gene:Ir7c / 31692 FlyBaseID:FBgn0029966 Length:625 Species:Drosophila melanogaster
Sequence 2:NP_001324013.1 Gene:GLR3.5 / 817800 AraportID:AT2G32390 Length:953 Species:Arabidopsis thaliana


Alignment Length:385 Identity:75/385 - (19%)
Similarity:138/385 - (35%) Gaps:99/385 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   288 DGEVNLTF-------VCFMYSKARSDLMLPS--TSYTSFP-------IVLVVPSGGSISPMGRLT 336
            ||:.|.::       ...::..|..|:.:.:  |.:..|.       :|:|.|..|:.|......
plant   538 DGKKNPSYDNLISEVAANIFDVAVGDVTIITNRTKFVDFTQPFIESGLVVVAPVKGAKSSPWSFL 602

  Fly   337 RPFRYIIWSCILVSLIFGFVLICLLKITALPGLRNLVLGRRNRLPFMG---------MWASLLGG 392
            :||...:|:  :...:|.||           |....:|..|....|.|         .|.|.  .
plant   603 KPFTIEMWA--VTGALFLFV-----------GAVIWILEHRFNEEFRGPPRRQIITVFWFSF--S 652

  Fly   393 LALYNPQRN----FARYILVMWLLQTLILRAAYTGQLYLLLQDVEMRSPIKSLSEVLAKD----- 448
            ...::.:.|    ..|::|::||...||:.::||..|..:|...::.|.|:.:..::|.:     
plant   653 TMFFSHRENTVSTLGRFVLLVWLFVVLIINSSYTASLTSILTVQQLTSRIEGMDTLIASNEPIGV 717

  Fly   449 -----------YEFRILPALRTIFKDSMPTTNFHAVLSLEESLYRLRDEDDPGITVALLQPTVNQ 502
                       .|..|.|:.....||.            ||.|..|:.....|...|::......
plant   718 QDGTFAWKFLVNELNIAPSRIIPLKDE------------EEYLSALQRGPRGGGVAAIVDELPYI 770

  Fly   503 FDFRSGPNKRHLTVLPDPLMT---------APLTFYMRPHSYFKRRIDRLIMAMMSSGIVARYRK 558
            ....|..|.:..||..:...|         :||...|          ...|:.:...|.:.:.||
plant   771 KALLSNSNCKFRTVGQEFTRTGWGFAFQRDSPLAVDM----------STAILQLAEEGKLEKIRK 825

  Fly   559 MYM----DRIKRVSKRRNLEPKPLSIWRLSGIFVCCAGLYLVALIVFILEILTTNHRRLR 614
            .::    :...::|...|.:....|.|   |:|:.|..::.:||.:|..::. ..::|||
plant   826 KWLTYDHECTMQISDTENYQISVQSFW---GLFLICGVVWFIALTLFCWKVF-WQYQRLR 881

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir7cNP_001245572.1 Lig_chan-Glu_bd 225..287 CDD:214911
Lig_chan 343..593 CDD:278489 55/291 (19%)
GLR3.5NP_001324013.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.